KEGG   Homo sapiens (human): 254122Help
Entry
254122            CDS       T01001                                 

Gene name
SNX32, SNX6B
Definition
(RefSeq) sorting nexin 32
  KO
K17920  sorting nexin-5/6/32
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    254122 (SNX32)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    254122 (SNX32)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Macropinocytosis
   Sorting nexins
    254122 (SNX32)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PX Vps5 Latarcin
Motif
Other DBs
NCBI-GeneID: 254122
NCBI-ProteinID: NP_689973
HGNC: 26423
Ensembl: ENSG00000172803
Vega: OTTHUMG00000128491
Pharos: Q86XE0(Tdark)
UniProt: Q86XE0
LinkDB All DBs
Structure
PDB: 

Position
11q13.1
AA seq 403 aa AA seqDB search
METYAEVGKEGKPSCASVDLQGDSSLQVEISDAVSERDKVKFTVQTKSCLPHFAQTEFSV
VRQHEEFIWLHDAYVENEEYAGLIIPPAPPRPDFEASREKLQKLGEGDSSVTREEFAKMK
QELEAEYLAIFKKTVAMHEVFLQRLAAHPTLRRDHNFFVFLEYGQDLSVRGKNRKELLGG
FLRNIVKSADEALITGMSGLKEVDDFFEHERTFLLEYHTRIRDACLRADRVMRAHKCLAD
DYIPISAALSSLGTQEVNQLRTSFLKLAELFERLRKLEGRVASDEDLKLSDMLRYYMRDS
QAAKDLLYRRLRALADYENANKALDKARTRNREVRPAESHQQLCCQRFERLSDSAKQELM
DFKSRRVSSFRKNLIELAELELKHAKASTLILRNTLVALKGEP
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atggagacgtatgcggaggttgggaaggagggcaagccttcctgtgcatcggtggatctg
cagggagacagctccttacaggtggagatttctgacgcagtgagtgagcgggacaaggtg
aaattcactgttcaaacaaagagctgcctccctcacttcgcccagaccgagttctcagtc
gtgcggcagcacgaggagttcatctggctgcatgatgcctacgtggagaatgaggagtac
gccggcctcatcatccccccagcccctccgaggccagactttgaggcttcgagggaaaag
ctacagaaattgggcgagggggacagctctgtcactcgggaagagtttgccaagatgaag
caggagctggaagcggagtacctggccatctttaagaagacagttgcgatgcacgaagtc
tttctgcagcgcctggcggcccaccccaccctgcgtcgagaccacaacttctttgtgttt
ttggaatatggacaggatctgagtgtccgggggaagaacaggaaggagctcctcggaggg
tttctgaggaatattgtgaagtccgcggatgaagccctcatcacgggcatgtcagggctc
aaggaggtggatgacttctttgagcatgagaggaccttcctgttggagtatcacacccgt
atccgagatgcctgcctgcgggccgaccgcgtcatgcgcgcccacaagtgcctggcagac
gattatatccctatctcagctgcgctgagcagtctgggaacacaggaagtcaaccagcta
aggacgagcttcctcaaattggcagagctctttgaacggctgaggaagctggagggccgg
gtggcttccgatgaggacctgaagctgtcagacatgctgaggtactacatgcgtgactca
caggcagccaaggacctgctgtaccggcggctgcgggcactggccgactacgagaatgcc
aacaaggcgctggacaaggcgcgcaccaggaaccgggaggtgcggcccgccgagagccac
cagcagctgtgctgccaacgcttcgagcgcctctccgactccgccaagcaagagctcatg
gacttcaagtcccgccgggtctcctcttttcgaaagaatctcattgagctggcagagctg
gagctcaaacacgccaaggccagcaccctgattctccggaacacccttgttgccctaaag
ggggagccttag

KEGG   Homo sapiens (human): 27131Help
Entry
27131             CDS       T01001                                 

Gene name
SNX5
Definition
(RefSeq) sorting nexin 5
  KO
K17920  sorting nexin-5/6/32
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    27131 (SNX5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    27131 (SNX5)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Macropinocytosis
   Sorting nexins
    27131 (SNX5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PX Vps5 BAR
Motif
Other DBs
NCBI-GeneID: 27131
NCBI-ProteinID: NP_055241
OMIM: 605937
HGNC: 14969
Ensembl: ENSG00000089006
Vega: OTTHUMG00000031953
Pharos: Q9Y5X3(Tbio)
UniProt: Q9Y5X3
LinkDB All DBs
Structure
PDB: 

Position
20p11.23
AA seq 404 aa AA seqDB search
MAAVPELLQQQEEDRSKLRSVSVDLNVDPSLQIDIPDALSERDKVKFTVHTKTTLPTFQS
PEFSVTRQHEDFVWLHDTLIETTDYAGLIIPPAPTKPDFDGPREKMQKLGEGEGSMTKEE
FAKMKQELEAEYLAVFKKTVSSHEVFLQRLSSHPVLSKDRNFHVFLEYDQDLSVRRKNTK
EMFGGFFKSVVKSADEVLFTGVKEVDDFFEQEKNFLINYYNRIKDSCVKADKMTRSHKNV
ADDYIHTAACLHSLALEEPTVIKKYLLKVAELFEKLRKVEGRVSSDEDLKLTELLRYYML
NIEAAKDLLYRRTKALIDYENSNKALDKARLKSKDVKLAEAHQQECCQKFEQLSESAKEE
LINFKRKRVAAFRKNLIEMSELEIKHARNNVSLLQSCIDLFKNN
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atggccgcggttcccgagttgctgcagcagcaggaggaggaccgcagcaagctgagatct
gtatctgtggacctgaatgttgatccctcgcttcagattgacatacctgatgcgctcagt
gagagagacaaagtcaaatttacagtgcacacaaagaccacactgcccacgtttcagagc
ccagagttttctgttacaaggcaacatgaagactttgtgtggctacatgacactcttatt
gaaacaacagactatgctgggcttattattccacctgctcctacgaagcccgactttgat
ggtcctcgagagaagatgcagaaactgggagaaggtgaagggtctatgaccaaagaagaa
tttgccaagatgaaacaagaactggaagctgagtatctcgctgtgtttaagaagactgtg
tcctcccatgaagtctttcttcagcggctttcttctcaccctgttctcagtaaagatcgc
aactttcatgttttcctggaatatgatcaggatctaagtgttaggcggaaaaatactaaa
gagatgtttggtggcttcttcaaaagtgtggtgaaaagtgctgatgaagtcctttttact
ggagttaaggaggtagatgacttctttgagcaagagaagaacttccttattaactattac
aataggatcaaagattcttgtgtgaaagctgacaaaatgaccagatctcataaaaatgtt
gccgatgactatatccacaccgcagcctgcttacatagcctggctttagaagagcccaca
gtcatcaaaaagtacctattgaaggttgctgagctatttgaaaaactaaggaaagtagag
ggtcgagtttcatcagatgaagatttgaagctaacagagctcctccgatactacatgctc
aacattgaagctgctaaggatctcttatacagacgcaccaaagccctcattgactatgag
aactcaaacaaagctctggataaggcccggttaaagagcaaagacgtcaagttggctgag
gcacaccagcaggagtgctgccagaaatttgaacaactttccgaatctgcaaaagaagaa
ctgataaatttcaaacggaagagagtggcagcatttagaaagaatctaattgaaatgtct
gaactggaaataaaacatgccaggaacaatgtctcccttttgcagagctgtattgacttg
ttcaagaataactga

KEGG   Homo sapiens (human): 58533Help
Entry
58533             CDS       T01001                                 

Gene name
SNX6, MSTP010, TFAF2
Definition
(RefSeq) sorting nexin 6
  KO
K17920  sorting nexin-5/6/32
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    58533 (SNX6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    58533 (SNX6)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Macropinocytosis
   Sorting nexins
    58533 (SNX6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PX Vps5 BAR
Motif
Other DBs
NCBI-GeneID: 58533
NCBI-ProteinID: NP_689419
OMIM: 606098
HGNC: 14970
Ensembl: ENSG00000129515
Vega: OTTHUMG00000140213
Pharos: Q9UNH7(Tbio)
UniProt: Q9UNH7 A0A0A0MRI2
LinkDB All DBs
Position
14q13.1
AA seq 406 aa AA seqDB search
MMEGLDDGPDFLSEEDRGLKAINVDLQSDAALQVDISDALSERDKVKFTVHTKSSLPNFK
QNEFSVVRQHEEFIWLHDSFVENEDYAGYIIPPAPPRPDFDASREKLQKLGEGEGSMTKE
EFTKMKQELEAEYLAIFKKTVAMHEVFLCRVAAHPILRRDLNFHVFLEYNQDLSVRGKNK
KEKLEDFFKNMVKSADGVIVSGVKDVDDFFEHERTFLLEYHNRVKDASAKSDRMTRSHKS
AADDYNRIGSSLYALGTQDSTDICKFFLKVSELFDKTRKIEARVSADEDLKLSDLLKYYL
RESQAAKDLLYRRSRSLVDYENANKALDKARAKNKDVLQAETSQQLCCQKFEKISESAKQ
ELIDFKTRRVAAFRKNLVELAELELKHAKGNLQLLQNCLAVLNGDT
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgatggaaggcctggacgacggcccggacttcctctcagaagaggaccgcggacttaaa
gcaataaatgtagatcttcaaagtgatgctgctctgcaggtggacatttctgatgctctt
agtgagcgggataaagtaaaattcactgttcacacaaagagttcattgccaaattttaaa
caaaacgagttttcagttgttcggcaacatgaggaatttatctggcttcatgattccttt
gttgaaaatgaagactatgcaggttatatcattccaccagcaccaccaagacctgatttt
gatgcttcaagggaaaaactacagaagcttggtgaaggagaagggtcaatgacgaaggaa
gaattcacaaagatgaaacaggaactggaagctgaatatttggcaatattcaagaagaca
gttgcgatgcatgaagtgttcctgtgtcgtgtggcagcacatcctattttgagaagagat
ttaaatttccatgtcttcttggaatataatcaagatttgagtgtgcgaggaaaaaataaa
aaagagaaacttgaagacttctttaaaaacatggttaaatcagcagatggagtaatcgtt
tcaggagtaaaggatgtagatgatttctttgagcacgaacgaacatttcttttggagtat
cataaccgagttaaggatgcatctgctaaatctgatagaatgacaagatcccacaaaagt
gctgcagatgattacaatagaattggttcttcattatatgctttaggaactcaggattct
acagatatatgcaagttttttctcaaagtttcagaactgttcgataaaacaagaaaaata
gaagcacgagtgtctgctgatgaagacctcaaactttctgatcttttaaaatattactta
agagaatctcaagctgctaaggatctcctgtatcgaaggtctaggtcactagtggattat
gaaaatgctaataaagcactggataaagcaagagcaaaaaataaagatgttctacaggcc
gaaacttcccaacaattatgttgtcagaaatttgaaaaaatatctgagtctgcaaaacaa
gaacttatagattttaagacaagaagagttgctgcattcagaaaaaatttagtggaactg
gcagagttagaactgaagcatgcaaagggtaatctacagttgctgcagaactgcctggca
gtgttaaatggagacacataa

DBGET integrated database retrieval system