KEGG   Homo sapiens (human): 2542
Entry
2542              CDS       T01001                                 

Gene name
SLC37A4, G6PT1, G6PT2, G6PT3, GSD1b, GSD1c, GSD1d, PRO0685, TRG-19, TRG19
Definition
(RefSeq) solute carrier family 37 member 4
  KO
K08171  MFS transporter, OPA family, solute carrier family 37 (glycerol-6-phosphate transporter), member 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04973  Carbohydrate digestion and absorption
Network
nt06017  Glycogen metabolism
  Element
N00816  Transport of glucose 6-phosphate
N00817  Mutation-inactivated SLC37A4 to transport of glucose 6-phosphate
Disease
H00069  Glycogen storage disease
H01760  Hepatic glycogen storage disease
H01939  Glycogen storage disease type I
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    2542 (SLC37A4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    2542 (SLC37A4)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC37: Sugar-phosphate/phosphate exchanger
   2542 (SLC37A4)
 Major facilitator superfamily (MFS)
  Phosphate and organophosphate transporters
   Organophosphate:Pi antiporter (OPA) family [TC:2.A.1.4]
    2542 (SLC37A4)
SSDB
Motif
Pfam: MFS_1 Sugar_tr
Other DBs
NCBI-GeneID: 2542
NCBI-ProteinID: NP_001157749
OMIM: 602671
HGNC: 4061
Ensembl: ENSG00000137700
Pharos: O43826(Tchem)
UniProt: O43826 A0A024R3H9 A8K0S7
LinkDB
Position
11q23.3
AA seq 429 aa
MAAQGYGYYRTVIFSAMFGGYSLYYFNRKTFSFVMPSLVEEIPLDKDDLGFITSSQSAAY
AISKFVSGVLSDQMSARWLFSSGLLLVGLVNIFFAWSSTVPVFAALWFLNGLAQGLGWPP
CGKVLRKWFEPSQFGTWWAILSTSMNLAGGLGPILATILAQSYSWRSTLALSGALCVVVS
FLCLLLIHNEPADVGLRNLDPMPSEGKKGSLKEESTLQELLLSPYLWVLSTGYLVVFGVK
TCCTDWGQFFLIQEKGQSALVGSSYMSALEVGGLVGSIAAGYLSDRAMAKAGLSNYGNPR
HGLLLFMMAGMTVSMYLFRVTVTSDSPKLWILVLGAVFGFSSYGPIALFGVIANESAPPN
LCGTSHAIVGLMANVGGFLAGLPFSTIAKHYSWSTAFWVAEVICAASTAAFFLLRNIRTK
MGRVSKKAE
NT seq 1290 nt   +upstreamnt  +downstreamnt
atggcagcccagggctatggctattatcgcactgtgatcttctcagccatgtttgggggc
tacagcctgtattacttcaatcgcaagaccttctcctttgtcatgccatcattggtggaa
gagatccctttggacaaggatgatttggggttcatcaccagcagccagtcggcagcttat
gctatcagcaagtttgtcagtggggtgctgtctgaccagatgagtgctcgctggctcttc
tcttctgggctgctcctggttggcctggtcaacatattctttgcctggagctccacagta
cctgtctttgctgccctctggttccttaatggcctggcccaggggctgggctggccccca
tgtgggaaggtcctgcggaagtggtttgagccatctcagtttggcacttggtgggccatc
ctgtcaaccagcatgaacctggctggagggctgggccctatcctggcaaccatccttgcc
cagagctacagctggcgcagcacgctggccctatctggggcactgtgtgtggttgtctcc
ttcctctgtctcctgctcatccacaatgaacctgctgatgttggactccgcaacctggac
cccatgccctctgagggcaagaagggctccttgaaggaggagagcaccctgcaggagctg
ctgctgtccccttacctgtgggtgctctccactggttaccttgtggtgtttggagtaaag
acctgctgtactgactggggccagttcttccttatccaggagaaaggacagtcagccctt
gtaggtagctcctacatgagtgccctggaagttgggggccttgtaggcagcatcgcagct
ggctacctgtcagaccgggccatggcaaaggcgggactgtccaactacgggaaccctcgc
catggcctgttgctgttcatgatggctggcatgacagtgtccatgtacctcttccgggta
acagtgaccagtgactcccccaagctctggatcctggtattgggagctgtatttggtttc
tcctcgtatggccccattgccctgtttggagtcatagccaacgagagtgcccctcccaac
ttgtgtggcacctcccacgccattgtgggactcatggccaatgtgggcggctttctggct
gggctgcccttcagcaccattgccaagcactacagttggagcacagccttctgggtggct
gaagtgatttgtgcggccagcacggctgccttcttcctcctacgaaacatccgcaccaag
atgggccgagtgtccaagaaggctgagtga

DBGET integrated database retrieval system