KEGG   Homo sapiens (human): 2549Help
Entry
2549              CDS       T01001                                 

Gene name
GAB1, DFNB26
Definition
(RefSeq) GRB2 associated binding protein 1
  KO
K09593  GRB2-associated-binding protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa01521  EGFR tyrosine kinase inhibitor resistance
hsa04012  ErbB signaling pathway
hsa04014  Ras signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04722  Neurotrophin signaling pathway
hsa05100  Bacterial invasion of epithelial cells
hsa05205  Proteoglycans in cancer
hsa05211  Renal cell carcinoma
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
Network
nt06214  PI3K signaling
nt06261  Gastric cancer
nt06263  Hepatocellular carcinoma
nt06264  Renal cell carcinoma
  Element
N00043  HGF-MET-PI3K signaling pathway
N00044  Mutation-activated MET to PI3K signaling pathway
N00247  HGF-overexpression to PI3K signaling pathway
N00249  MET-overexpression to PI3K signaling pathway
N00260  Amplified MET to PI3K signaling pathway
Disease
H00605  Deafness, autosomal recessive
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    2549 (GAB1)
   04012 ErbB signaling pathway
    2549 (GAB1)
   04072 Phospholipase D signaling pathway
    2549 (GAB1)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    2549 (GAB1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    2549 (GAB1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    2549 (GAB1)
   05226 Gastric cancer
    2549 (GAB1)
   05211 Renal cell carcinoma
    2549 (GAB1)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    2549 (GAB1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    2549 (GAB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PH PH_11 PH_3 PH_8 PH_9 PH_13
Motif
Other DBs
NCBI-GeneID: 2549
NCBI-ProteinID: NP_002030
OMIM: 604439
HGNC: 4066
Ensembl: ENSG00000109458
Vega: OTTHUMG00000161432
Pharos: Q13480(Tbio)
UniProt: Q13480 Q9HA84
LinkDB All DBs
Position
4q31.21
AA seq 694 aa AA seqDB search
MSGGEVVCSGWLRKSPPEKKLKRYAWKRRWFVLRSGRLTGDPDVLEYYKNDHAKKPIRII
DLNLCQQVDAGLTFNKKEFENSYIFDINTIDRIFYLVADSEEEMNKWVRCICDICGFNPT
EEDPVKPPGSSLQAPADLPLAINTAPPSTQADSSSATLPPPYQLINVPPHLETLGIQEDP
QDYLLLINCQSKKPEPTRTHADSAKSTSSETDCNDNVPSHKNPASSQSKHGMNGFFQQQM
IYDSPPSRAPSASVDSSLYNLPRSYSHDVLPKVSPSSTEADGELYVFNTPSGTSSVETQM
RHVSISYDIPPTPGNTYQIPRTFPEGTLGQTSKLDTIPDIPPPRPPKPHPAHDRSPVETC
SIPRTASDTDSSYCIPTAGMSPSRSNTISTVDLNKLRKDASSQDCYDIPRAFPSDRSSSL
EGFHNHFKVKNVLTVGSVSSEELDENYVPMNPNSPPRQHSSSFTEPIQEANYVPMTPGTF
DFSSFGMQVPPPAHMGFRSSPKTPPRRPVPVADCEPPPVDRNLKPDRKVKPAPLEIKPLP
EWEELQAPVRSPITRSFARDSSRFPMSPRPDSVHSTTSSSDSHDSEENYVPMNPNLSSED
PNLFGSNSLDGGSSPMIKPKGDKQVEYLDLDLDSGKSTPPRKQKSSGSGSSVADERVDYV
VVDQQKTLALKSTREAWTDGRQSTESETPAKSVK
NT seq 2085 nt NT seq  +upstreamnt  +downstreamnt
atgagcggtggtgaagtggtctgctccggatggctccgcaagtcccccccggagaaaaag
ttgaagcgttatgcatggaagaggagatggttcgtgttacgcagtggccgtttaactgga
gatccagatgttttggaatattacaaaaatgatcatgccaagaagcctattcgtattatt
gatttaaatttatgtcaacaagtagatgctggattgacatttaacaaaaaagagtttgaa
aacagctacatttttgatatcaacactattgaccggattttctacttggtagcagacagc
gaggaggagatgaataagtgggttcgttgtatttgtgacatctgtgggtttaatccaaca
gaagaagatcctgtgaagccacctggcagctctttacaagcaccagctgatttaccttta
gctataaatacagcaccaccatccacccaggcagattcatcctctgctactctacctcct
ccatatcagctaatcaatgttccaccacacctggaaactcttggcattcaggaggatcct
caagactacctgttgctcatcaactgtcaaagcaagaagcccgaacccaccagaacgcat
gctgattctgcaaaatccacctcttctgaaacagactgcaatgataacgtcccttctcat
aaaaatcctgcttcctcccagagcaaacatggaatgaatggcttttttcagcagcaaatg
atatacgactctccaccttcacgtgccccatctgcttcagttgactccagcctttataac
ctgcccaggagttattcccatgatgttttaccaaaggtgtctccatcaagtactgaagca
gatggagaactctatgtttttaataccccatctgggacatcgagtgtagagactcaaatg
aggcatgtatctattagttatgacattcctccaacacctggtaatacttatcagattcca
cgaacatttccagaaggaaccttgggacagacatcaaagctagacactattccagatatt
cctccacctcggccaccgaaaccacatccagctcatgaccgatctcctgtggaaacgtgt
agtatcccacgcaccgcctcagacactgacagtagttactgtatccctacagcagggatg
tcgccttcacgtagtaataccatttccactgtggatttaaacaaattgcgaaaagatgct
agttctcaagactgctatgatattccacgagcatttccaagtgatagatctagttcactt
gaaggcttccataaccactttaaagtcaaaaatgtgttgacagtgggaagtgtttcaagt
gaagaactggatgaaaattacgtcccaatgaatcccaattcaccaccacgacaacattcc
agcagttttacagaaccaattcaggaagcaaattatgtgccaatgactccaggaacattt
gatttttcctcatttggaatgcaagttcctcctcctgctcatatgggcttcaggtccagc
ccaaaaacccctcccagaaggccagttcctgttgcagactgtgaaccaccccccgtggat
aggaacctcaagccagacagaaaagtcaagccagcgcctttagaaataaaacctttgcca
gaatgggaagaattacaagccccagttagatctcccatcactaggagttttgctcgagac
tcttccaggtttcccatgtccccccgaccagattcagtgcatagcacaacttcaagcagt
gactcacacgacagtgaagagaattatgttcccatgaacccaaacctgtccagtgaagac
ccaaatctctttggcagtaacagtcttgatggaggaagcagccctatgatcaagcccaaa
ggagacaaacaggtggaatacttagatctcgacttagattctgggaaatccacaccacca
cgtaagcaaaagagcagtggctcaggcagcagtgtagcagatgagagagtggattatgtt
gttgttgaccaacagaagaccttggctctaaagagtacccgggaagcctggacagatggg
agacagtccacagaatcagaaacgccagcgaagagtgtgaaatga

DBGET integrated database retrieval system