KEGG   Homo sapiens (human): 255022
Entry
255022            CDS       T01001                                 

Gene name
CALHM1, FAM26C
Definition
(RefSeq) calcium homeostasis modulator 1
  KO
K19738  calcium homeostasis modulator protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04742 Taste transduction
    255022 (CALHM1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    255022 (CALHM1)
Transporters [BR:hsa02000]
 Other transporters
  Pores ion channels [TC:1]
   255022 (CALHM1)
SSDB
Motif
Pfam: Ca_hom_mod
Other DBs
NCBI-GeneID: 255022
NCBI-ProteinID: NP_001001412
OMIM: 612234
HGNC: 23494
Ensembl: ENSG00000185933
Vega: OTTHUMG00000018991
Pharos: Q8IU99(Tbio)
UniProt: Q8IU99
LinkDB
Position
10q24.33
AA seq 346 aa
MMDKFRMIFQFLQSNQESFMNGICGIMALASAQMYSAFDFNCPCLPGYNAAYSAGILLAP
PLVLFLLGLVMNNNVSMLAEEWKRPLGRRAKDPAVLRYMFCSMAQRALIAPVVWVAVTLL
DGKCFLCAFCTAVPVSALGNGSLAPGLPAPELARLLARVPCPEIYDGDWLLAREVAVRYL
RCISQALGWSFVLLTTLLAFVVRSVRPCFTQAAFLKSKYWSHYIDIERKLFDETCTEHAK
AFAKVCIQQFFEAMNHDLELGHTHGTLATAPASAAAPTTPDGAEEEREKLRGITDQGTMN
RLLTSWHKCKPPLRLGQEEPPLMGNGWAGGGPRPPRKEVATYFSKV
NT seq 1041 nt   +upstreamnt  +downstreamnt
atgatggacaagttccggatgatcttccagttcctgcagtccaaccaggagtccttcatg
aatggcatctgtggcatcatggccctggccagtgcccagatgtactcggccttcgacttc
aactgcccctgcctgccgggctacaatgcagcctacagcgcgggcatcctgctggcgcca
cccctggtgctctttctgcttggcctggtcatgaacaacaacgtgtccatgctggccgaa
gagtggaagcggccgctgggccgccgggccaaggaccccgctgtgttgcgctacatgttc
tgctccatggcccagcgcgccctcatcgcgcctgtcgtctgggtggccgtcacgctactc
gacggcaaatgcttcctctgtgccttctgcactgccgtgcccgtgagcgcactgggcaac
ggcagcctggcacccggccttcctgcccccgagctcgcccgcctgctggcccgggtgccc
tgccctgagatctacgatggcgactggctgttggcccgagaggtggccgtgcgttacctc
cgctgcatctcccaggcgctgggctggtccttcgtgctgctgaccactctgctggcattc
gtggtgcgctctgtgcggccctgcttcacgcaggccgccttcctcaagagcaagtactgg
tcccactatatcgacatcgagcgcaagctcttcgacgagacgtgcacggagcacgccaaa
gcctttgccaaggtctgcatccagcagttcttcgaggccatgaaccatgacctggagctg
ggtcacacccacgggacactggccacggcccctgcttccgcagctgcccccacgaccccc
gatggtgcggaggaggaaagggagaagctgcgtggcatcacggatcaaggcaccatgaac
aggctgctcacgagctggcacaaatgcaaaccgcctctgcggctgggccaggaggagcca
ccgctgatgggcaacggctgggctgggggtgggccccggcctccgcgtaaggaggtggcc
acctacttcagcaaagtgtga

DBGET integrated database retrieval system