KEGG   Homo sapiens (human): 255027
Entry
255027            CDS       T01001                                 

Gene name
MPV17L, M-LPH, MLPH1, MLPH2, MPV17L1
Definition
(RefSeq) MPV17 mitochondrial inner membrane protein like
  KO
K13349  Mpv17-like protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    255027 (MPV17L)
SSDB
Motif
Pfam: Mpv17_PMP22
Other DBs
NCBI-GeneID: 255027
NCBI-ProteinID: NP_001121895
OMIM: 618100
HGNC: 26827
Ensembl: ENSG00000156968
Vega: OTTHUMG00000129882
Pharos: Q2QL34(Tbio)
UniProt: Q2QL34
LinkDB
Position
16p13.11
AA seq 196 aa
MAGWWPALSRAARRHPWPTNVLLYGSLVSAGDALQQRLQGREANWRQTRRVATLVVTFHA
NFNYVWLRLLERALPGRAPHALLAKLLCDQVVGAPIAVSAFYVGMSILQGKDDIFLDLKQ
KFWNTYLSGLMYWPFVQLTNFSLVPVQWRTAYAGVCGFLWATFICFSQQSGDGTFKSAFT
ILYTKGTSATEGYPKK
NT seq 591 nt   +upstreamnt  +downstreamnt
atggcgggctggtggccggcgttgtcgcgcgcggcccggcgccacccgtggcccaccaac
gtgctgctttacggctcgctcgtctcggccggggacgcgctgcaacagcggctgcagggc
cgcgaggccaactggcgccagacgcggcgcgtggccacgttggtggtgaccttccacgcc
aacttcaactacgtgtggctgcgcctgctggagcgcgcgctcccgggccgagcgccgcac
gccctgctggccaagttgctgtgcgaccaggtggtcggtgcgcccatcgcggtctcggcc
ttctatgtcggtatgagcattctccaaggaaaggatgacatatttttggacctgaaacag
aaattctggaatacctatctgagtggactgatgtactggccctttgtacagctgaccaac
ttcagccttgttcctgttcaatggagaacagcttacgctggagtctgtggttttctctgg
gccaccttcatctgtttttcccagcagagtggtgacggcacattcaagtcagctttcacc
attttatatacaaaggggaccagtgccacagaagggtacccgaagaaatga

KEGG   Homo sapiens (human): 4358
Entry
4358              CDS       T01001                                 

Gene name
MPV17, CMT2EE, MTDPS6, SYM1
Definition
(RefSeq) mitochondrial inner membrane protein MPV17
  KO
K13348  protein Mpv17
Organism
hsa  Homo sapiens (human)
Pathway
hsa04146  Peroxisome
Disease
H00469  Mitochondrial DNA depletion syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    4358 (MPV17)
SSDB
Motif
Pfam: Mpv17_PMP22
Other DBs
NCBI-GeneID: 4358
NCBI-ProteinID: NP_002428
OMIM: 137960
HGNC: 7224
Ensembl: ENSG00000115204
Vega: OTTHUMG00000097074
Pharos: P39210(Tbio)
UniProt: P39210 A0A0S2Z3Z9
LinkDB
Position
2p23.3
AA seq 176 aa
MALWRAYQRALAAHPWKVQVLTAGSLMGLGDIISQQLVERRGLQEHQRGRTLTMVSLGCG
FVGPVVGGWYKVLDRFIPGTTKVDALKKMLLDQGGFAPCFLGCFLPLVGALNGLSAQDNW
AKLQRDYPDALITNYYLWPAVQLANFYLVPLHYRLAVVQCVAVIWNSYLSWKAHRL
NT seq 531 nt   +upstreamnt  +downstreamnt
atggcactctggcgggcataccagcgggccctggccgctcacccgtggaaagtacaggtc
ctgacagctgggtccctgatgggcctgggtgacattatctcacagcagctggtggagagg
cggggtctgcaggaacaccagagaggccggactctgaccatggtgtccctgggctgtggc
tttgtgggccctgtggtaggaggctggtacaaggttttggatcggttcatccctggcacc
accaaagtggatgcactgaagaagatgttgttggatcaggggggctttgccccgtgtttt
ctaggctgctttctcccactggtaggggcacttaatggactgtcagcccaggacaactgg
gccaaactacagcgggattatcctgatgcccttatcaccaactactatctatggcctgct
gtgcagttagccaacttctacctggtcccccttcattacaggttggccgttgtccaatgt
gttgctgttatctggaactcctacctgtcctggaaggcacatcggctctaa

KEGG   Homo sapiens (human): 84769
Entry
84769             CDS       T01001                                 

Gene name
MPV17L2, FKSG24
Definition
(RefSeq) MPV17 mitochondrial inner membrane protein like 2
  KO
K13348  protein Mpv17
Organism
hsa  Homo sapiens (human)
Pathway
hsa04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    84769 (MPV17L2)
SSDB
Motif
Pfam: Mpv17_PMP22
Other DBs
NCBI-GeneID: 84769
NCBI-ProteinID: NP_116072
OMIM: 616133
HGNC: 28177
Ensembl: ENSG00000254858
Vega: OTTHUMG00000165628
Pharos: Q567V2(Tbio)
UniProt: Q567V2 A0A024R7K6
LinkDB
Position
19p13.11
AA seq 206 aa
MARGGWRRLRRLLSAGQLLFQGRALLVTNTLGCGALMAAGDGVRQSWEIRARPGQVFDPR
RSASMFAVGCSMGPFLHYWYLSLDRLFPASGLRGFPNVLKKVLVDQLVASPLLGVWYFLG
LGCLEGQTVGESCQELREKFWEFYKADWCVWPAAQFVNFLFVPPQFRVTYINGLTLGWDT
YLSYLKYRSPVPLTPPGCVALDTRAD
NT seq 621 nt   +upstreamnt  +downstreamnt
atggcgcggggtggctggcgccggctacgccgcctgttatccgcggggcagcttctattc
cagggccgcgcgctgctcgtcactaacacgctgggctgcggcgcgctcatggcggccggt
gatggcgtgcgccagtcctgggagatccgcgcccggcccggccaggttttcgacccacgg
cgctccgcgagcatgtttgcggtgggctgcagcatgggtcccttcctgcactactggtac
ttgtcgctggaccgcctattccctgcgtctggcctccgaggcttcccaaatgtcctcaag
aaggtcctcgtggatcagctggtagcctctccattgctgggcgtctggtacttcttgggc
cttggctgcctggagggtcagacagtgggtgagagctgccaggagctgcgggagaagttc
tgggaattctacaaggcagactggtgcgtgtggcctgctgcgcagttcgtgaacttcctc
ttcgtgcccccccaatttcgagtcacctacatcaacggcctgacgctgggctgggacacg
tacctgtcctacttgaagtaccggagcccagttcctctgacacccccaggctgtgtggcc
ctggacacccgagcagactga

DBGET integrated database retrieval system