KEGG   Homo sapiens (human): 255061
Entry
255061            CDS       T01001                                 

Gene name
TAC4, EK, HK-1, HK1, PPT-C
Definition
(RefSeq) tachykinin precursor 4
  KO
K05241  tachykinin 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    255061 (TAC4)
SSDB
Other DBs
NCBI-GeneID: 255061
NCBI-ProteinID: NP_733786
OMIM: 607833
HGNC: 16641
Ensembl: ENSG00000176358
Vega: OTTHUMG00000161830
Pharos: Q86UU9(Tbio)
UniProt: Q86UU9
LinkDB
Position
17q21.33
AA seq 113 aa
MLPCLALLLLMELSVCTVAGDGGEEQTLSTEAETWVIVALEEGAGPSIQLQLQEVKTGKA
SQFFGLMGKRVGGRPLIQPRRKKAYQLEHTFQGLLGKRSLFTEGREDEAQGSE
NT seq 342 nt   +upstreamnt  +downstreamnt
atgctgccttgcctcgccctgcttctcctgatggagctgtccgtgtgcactgtggcaggt
gatggtggagaggaacagacactcagcactgaagcagagacctgggtaattgtggccttg
gaggaaggcgctggccccagcattcagctccagctgcaggaggtgaagacgggcaaggca
agccagttctttgggctgatggggaagcgagtgggaggaagacctctgatccagccaagg
agaaaaaaagcatatcagctggaacacacgttccagggcctcctgggcaagagaagcctg
ttcacagaaggcagagaggatgaggcccaaggttcagagtaa

KEGG   Homo sapiens (human): 6863
Entry
6863              CDS       T01001                                 

Gene name
TAC1, Hs.2563, NK2, NKNA, NPK, TAC2
Definition
(RefSeq) tachykinin precursor 1
  KO
K05239  tachykinin 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    6863 (TAC1)
SSDB
Motif
Pfam: Tachykinin
Other DBs
NCBI-GeneID: 6863
NCBI-ProteinID: NP_003173
OMIM: 162320
HGNC: 11517
Ensembl: ENSG00000006128
Vega: OTTHUMG00000154069
Pharos: P20366(Tbio)
CPD: C16094 C16095 C16096 C16097
UniProt: P20366
LinkDB
Position
7q21.3
AA seq 129 aa
MKILVALAVFFLVSTQLFAEEIGANDDLNYWSDWYDSDQIKEELPEPFEHLLQRIARRPK
PQQFFGLMGKRDADSSIEKQVALLKALYGHGQISHKRHKTDSFVGLMGKRALNSVAYERS
AMQNYERRR
NT seq 390 nt   +upstreamnt  +downstreamnt
atgaaaatcctcgtggccttggcagtcttttttcttgtctccactcagctgtttgcagaa
gaaataggagccaatgatgatctgaattactggtccgactggtacgacagcgaccagatc
aaggaggaactgccggagccctttgagcatcttctgcagagaatcgcccggagacccaag
cctcagcagttctttggattaatgggcaaacgggatgctgattcctcaattgaaaaacaa
gtggccctgttaaaggctctttatggacatggccagatctctcacaaaagacataaaaca
gattcctttgttggactaatgggcaaaagagctttaaattctgtggcttatgaaaggagt
gcaatgcagaattatgaaagaagacgttaa

DBGET integrated database retrieval system