KEGG   Homo sapiens (human): 2554
Entry
2554              CDS       T01001                                 

Gene name
GABRA1, DEE19, ECA4, EIEE19, EJM, EJM5
Definition
(RefSeq) gamma-aminobutyric acid type A receptor subunit alpha1
  KO
K05175  gamma-aminobutyric acid receptor subunit alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04723  Retrograde endocannabinoid signaling
hsa04727  GABAergic synapse
hsa04742  Taste transduction
hsa05032  Morphine addiction
hsa05033  Nicotine addiction
Disease
H00606  Early infantile epileptic encephalopathy
H00808  Idiopathic generalized epilepsies
H02215  Childhood absence epilepsy
H02217  Juvenile myoclonic epilepsy
Drug target
Abecarnil: D02594
Adinazolam (DG00911): D02770 D02771
Adipiplon: D08840
Alpidem: D02833
Alprazolam: D00225<JP/US>
Aminobutyric acid: D00058<JP>
Amobarbital (DG00916): D00555<JP> D02252
Aprobarbital: D00698
Barbexaclone: D07298
Barbital: D01740
Bretazenil: D03155
Brexanolone: D11149<US>
Bromazepam: D01245<JP>
Brotizolam: D01744<JP>
Butabarbital (DG01308): D00699 D03180
Butobarbital: D02618
Cenobamate: D11150<US>
Chlordiazepoxide (DG00908): D00267<JP> D00693<US>
Cinolazepam: D07328
Clobazam: D01253<JP/US>
Clomethiazole (DG00923): D07330 D07725
Clonazepam: D00280<JP/US>
Clotiazepam: D01328<JP>
Cloxazolam: D01268<JP>
Delorazepam: D07784
Dextofisopam: D03737
Diazepam: D00293<JP/US>
Estazolam: D00311<JP/US>
Eszopiclone: D02624<JP/US>
Ethyl loflazepate: D01293<JP>
Etizolam: D01514<JP>
Etomidate: D00548<US>
Fludiazepam: D01354<JP>
Flumazenil: D00697<JP/US>
Flunitrazepam: D01230<JP>
Flurazepam (DG00919): D00329 D00695<US> D01408<JP>
Flutazolam: D01286<JP>
Flutoprazepam: D01279<JP>
Gaboxadol: D04282
Ganaxolone: D04300
Glutethimide: D00532
Halazepam: D00338
Haloxazolam: D01758<JP>
Hexobarbital: D01071
Indiplon: D02640
Iomazenil: D02283<JP>
Ketazolam: D04650
Levotofisopam: D04721
Loprazolam (DG00921): D07326 D08145
Lorazepam: D00365<JP/US>
Lormetazepam: D01657<JP>
Medazepam (DG00909): D01292<JP> D04882
Meprobamate: D00376<US>
Metharbital: D01382
Methohexital (DG00789): D00712<US> D04985
Methylphenobarbital: D00700
Methyprylon: D01150
Mexazolam: D01316<JP>
Midazolam (DG00920): D00550<JP/US> D00696<US> D05028
Nimetazepam: D01593
Nitrazepam: D00531<JP>
Nordazepam: D08283
Ocinaplon: D02617
Oxazepam: D00464<US>
Oxazolam: D01278<JP>
Pagoclone: D02616
Panadiplon: D05346
Pazinaclone: D05378
Pentobarbital (DG00915): D00499 D00500<US> D02253<JP>
Phenobarbital (DG00845): D00506<JP> D00701<JP> D08356
Potassium clorazepate (DG01218): D00694<JP/US> D03562
Prazepam: D00470
Progabide: D05621
Propofol (DG00797): D00549<JP/US> D04257
Quazepam: D00457<JP/US>
Remimazolam (DG03105): D10194<JP/US> D11788
Rilmazafone (DG01307): D01564<JP> D08481
Sarmazenil: D08507
Secobarbital (DG00917): D00430 D01310<JP/US>
Suritozole: D05980
Talbutal: D06887
Temazepam: D00370<US>
Thiamylal (DG01377): D00713<JP> D06106
Thiopental (DG00790): D00714<JP>
Tofisopam: D01254<JP>
Topiramate: D00537<JP/US>
Triazolam: D00387<JP/US>
Zaleplon: D00530<US>
Zolpidem (DG00922): D00706<JP/US> D08690
Zopiclone: D01372<JP>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2554 (GABRA1)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    2554 (GABRA1)
   04723 Retrograde endocannabinoid signaling
    2554 (GABRA1)
  09157 Sensory system
   04742 Taste transduction
    2554 (GABRA1)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    2554 (GABRA1)
   05033 Nicotine addiction
    2554 (GABRA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    2554 (GABRA1)
Ion channels [BR:hsa04040]
 Ligand-gated channels
  GABA-A
   2554 (GABRA1)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Other DBs
NCBI-GeneID: 2554
NCBI-ProteinID: NP_000797
OMIM: 137160
HGNC: 4075
Ensembl: ENSG00000022355
Vega: OTTHUMG00000163586
Pharos: P14867(Tclin)
UniProt: P14867 A8K177
LinkDB
Structure
PDB: 
6I53 5O8F 6D6T 6D6U

Position
5q34
AA seq 456 aa
MRKSPGLSDCLWAWILLLSTLTGRSYGQPSLQDELKDNTTVFTRILDRLLDGYDNRLRPG
LGERVTEVKTDIFVTSFGPVSDHDMEYTIDVFFRQSWKDERLKFKGPMTVLRLNNLMASK
IWTPDTFFHNGKKSVAHNMTMPNKLLRITEDGTLLYTMRLTVRAECPMHLEDFPMDAHAC
PLKFGSYAYTRAEVVYEWTREPARSVVVAEDGSRLNQYDLLGQTVDSGIVQSSTGEYVVM
TTHFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLNRESVPARTVFGVTTVLTMTTLSISA
RNSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNYFTKRGYAWDGKSVVPEKPKKVKDP
LIKKNNTYAPTATSYTPNLARGDPGLATIAKSATIEPKEVKPETKPPEPKKTFNSVSKID
RLSRIAFPLLFGIFNLVYWATYLNREPQLKAPTPHQ
NT seq 1371 nt   +upstreamnt  +downstreamnt
atgaggaaaagtccaggtctgtctgactgtctttgggcctggatcctccttctgagcaca
ctgactggaagaagctatggacagccgtcattacaagatgaacttaaagacaataccact
gtcttcaccaggattttggacagactcctagatggttatgacaatcgcctgagaccagga
ttgggagagcgtgtaaccgaagtgaagactgatatcttcgtcaccagtttcggacccgtt
tcagaccatgatatggaatatacaatagatgtatttttccgtcaaagctggaaggatgaa
aggttaaaatttaaaggacctatgacagtcctccggttaaataacctaatggcaagtaaa
atctggactccggacacatttttccacaatggaaagaagtcagtggcccacaacatgacc
atgcccaacaaactcctgcggatcacagaggatggcaccttgctgtacaccatgaggctg
acagtgagagctgaatgtccgatgcatttggaggacttccctatggatgcccatgcttgc
ccactaaaatttggaagttatgcttatacaagagcagaagttgtttatgaatggaccaga
gagccagcacgctcagtggttgtagcagaagatggatcacgtctaaaccagtatgacctt
cttggacaaacagtagactctggaattgtccagtcaagtacaggagaatatgttgttatg
accactcatttccacttgaagagaaagattggctactttgttattcaaacatacctgcca
tgcataatgacagtgattctctcacaagtctccttctggctcaacagagagtctgtacca
gcaagaactgtctttggagtaacaactgtgctcaccatgacaacattgagcatcagtgcc
agaaactccctccctaaggtggcttatgcaacagctatggattggtttattgccgtgtgc
tatgcctttgtgttctcagctctgattgagtttgccacagtaaactatttcactaagaga
ggttatgcatgggatggcaaaagtgtggttccagaaaagccaaagaaagtaaaggatcct
cttattaagaaaaacaacacttacgctccaacagcaaccagctacacccctaatttggcc
aggggcgacccgggcttagccaccattgctaaaagtgcaaccatagaacctaaagaggtc
aagcccgaaacaaaaccaccagaacccaagaaaacctttaacagtgtcagcaaaattgac
cgactgtcaagaatagccttcccgctgctatttggaatctttaacttagtctactgggct
acgtatttaaacagagagcctcagctaaaagcccccacaccacatcaatag

KEGG   Homo sapiens (human): 2555
Entry
2555              CDS       T01001                                 

Gene name
GABRA2, EIEE78
Definition
(RefSeq) gamma-aminobutyric acid type A receptor subunit alpha2
  KO
K05175  gamma-aminobutyric acid receptor subunit alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04723  Retrograde endocannabinoid signaling
hsa04727  GABAergic synapse
hsa04742  Taste transduction
hsa05032  Morphine addiction
hsa05033  Nicotine addiction
Disease
H00606  Early infantile epileptic encephalopathy
H01611  Alcohol dependence
Drug target
Abecarnil: D02594
Adinazolam (DG00911): D02770 D02771
Adipiplon: D08840
Alpidem: D02833
Alprazolam: D00225<JP/US>
Aminobutyric acid: D00058<JP>
Amobarbital (DG00916): D00555<JP> D02252
Aprobarbital: D00698
Barbexaclone: D07298
Barbital: D01740
Bretazenil: D03155
Brexanolone: D11149<US>
Bromazepam: D01245<JP>
Brotizolam: D01744<JP>
Butabarbital (DG01308): D00699 D03180
Butobarbital: D02618
Cenobamate: D11150<US>
Chlordiazepoxide (DG00908): D00267<JP> D00693<US>
Cinolazepam: D07328
Clobazam: D01253<JP/US>
Clonazepam: D00280<JP/US>
Clotiazepam: D01328<JP>
Cloxazolam: D01268<JP>
Delorazepam: D07784
Dextofisopam: D03737
Diazepam: D00293<JP/US>
Estazolam: D00311<JP/US>
Eszopiclone: D02624<JP/US>
Ethyl loflazepate: D01293<JP>
Etizolam: D01514<JP>
Fludiazepam: D01354<JP>
Flumazenil: D00697<JP/US>
Flunitrazepam: D01230<JP>
Flurazepam (DG00919): D00329 D00695<US> D01408<JP>
Flutazolam: D01286<JP>
Flutoprazepam: D01279<JP>
Gaboxadol: D04282
Ganaxolone: D04300
Glutethimide: D00532
Halazepam: D00338
Haloxazolam: D01758<JP>
Hexobarbital: D01071
Indiplon: D02640
Iomazenil: D02283<JP>
Ketazolam: D04650
Levotofisopam: D04721
Loprazolam (DG00921): D07326 D08145
Lorazepam: D00365<JP/US>
Lormetazepam: D01657<JP>
Medazepam (DG00909): D01292<JP> D04882
Meprobamate: D00376<US>
Metharbital: D01382
Methylphenobarbital: D00700
Mexazolam: D01316<JP>
Midazolam (DG00920): D00550<JP/US> D00696<US> D05028
Nimetazepam: D01593
Nitrazepam: D00531<JP>
Nordazepam: D08283
Ocinaplon: D02617
Oxazepam: D00464<US>
Oxazolam: D01278<JP>
Pagoclone: D02616
Panadiplon: D05346
Pazinaclone: D05378
Pentobarbital (DG00915): D00499 D00500<US> D02253<JP>
Phenobarbital (DG00845): D00506<JP> D00701<JP> D08356
Potassium clorazepate (DG01218): D00694<JP/US> D03562
Prazepam: D00470
Propofol (DG00797): D00549<JP/US> D04257
Quazepam: D00457<JP/US>
Remimazolam (DG03105): D10194<JP/US> D11788
Rilmazafone (DG01307): D01564<JP> D08481
Sarmazenil: D08507
Secobarbital (DG00917): D00430 D01310<JP/US>
Suritozole: D05980
Talbutal: D06887
Temazepam: D00370<US>
Thiamylal (DG01377): D00713<JP> D06106
Thiopental (DG00790): D00714<JP>
Tofisopam: D01254<JP>
Topiramate: D00537<JP/US>
Triazolam: D00387<JP/US>
Zolpidem (DG00922): D00706<JP/US> D08690
Zopiclone: D01372<JP>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2555 (GABRA2)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    2555 (GABRA2)
   04723 Retrograde endocannabinoid signaling
    2555 (GABRA2)
  09157 Sensory system
   04742 Taste transduction
    2555 (GABRA2)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    2555 (GABRA2)
   05033 Nicotine addiction
    2555 (GABRA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    2555 (GABRA2)
Ion channels [BR:hsa04040]
 Ligand-gated channels
  GABA-A
   2555 (GABRA2)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb CytochromB561_N DUF5522
Other DBs
NCBI-GeneID: 2555
NCBI-ProteinID: NP_000798
OMIM: 137140
HGNC: 4076
Ensembl: ENSG00000151834
Vega: OTTHUMG00000044266
Pharos: P47869(Tclin)
UniProt: P47869 A0A024R9X6
LinkDB
Structure
PDB: 
5O8F

Position
4p12
AA seq 451 aa
MKTKLNIYNMQFLLFVFLVWDPARLVLANIQEDEAKNNITIFTRILDRLLDGYDNRLRPG
LGDSITEVFTNIYVTSFGPVSDTDMEYTIDVFFRQKWKDERLKFKGPMNILRLNNLMASK
IWTPDTFFHNGKKSVAHNMTMPNKLLRIQDDGTLLYTMRLTVQAECPMHLEDFPMDAHSC
PLKFGSYAYTTSEVTYIWTYNASDSVQVAPDGSRLNQYDLLGQSIGKETIKSSTGEYTVM
TAHFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLNRESVPARTVFGVTTVLTMTTLSISA
RNSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNYFTKRGWAWDGKSVVNDKKKEKASV
MIQNNAYAVAVANYAPNLSKDPVLSTISKSATTPEPNKKPENKPAEAKKTFNSVSKIDRM
SRIVFPVLFGTFNLVYWATYLNREPVLGVSP
NT seq 1356 nt   +upstreamnt  +downstreamnt
atgaagacaaaattgaacatctacaacatgcagttcctgctttttgttttcttggtgtgg
gaccctgccaggttggtgctggctaacatccaagaagatgaggctaaaaataacattacc
atctttacgagaattcttgacagacttctggatggttacgataatcggcttagaccagga
ctgggagacagtattactgaagtcttcactaacatctacgtgaccagttttggccctgtc
tcagatacagatatggaatatacaattgatgttttctttcgacaaaaatggaaagatgaa
cgtttaaaatttaaaggtcctatgaatatccttcgactaaacaatttaatggctagcaaa
atctggactccagataccttttttcacaatgggaaaaaatcagtagctcataatatgaca
atgccaaataagttgcttcgaattcaggatgatgggactctgctgtataccatgaggctt
acagttcaagctgaatgcccaatgcacttggaggatttcccaatggatgctcattcatgt
cctctgaaatttggcagctatgcatatacaacttcagaggtcacttatatttggacttac
aatgcatctgattcagtacaggttgctcctgatggctctaggttaaatcaatatgacctg
ctgggccaatcaatcggaaaggagacaattaaatccagtacaggtgaatatactgtaatg
acagctcatttccacctgaaaagaaaaattgggtattttgtgattcaaacctatctgcct
tgcatcatgactgtcattctctcccaagtttcattctggcttaacagagaatctgtgcct
gcaagaactgtgtttggagtaacaactgtcctaacaatgacaactctaagcatcagtgct
cggaattctctccccaaagtggcttatgcaactgccatggactggtttattgctgtttgt
tatgcatttgtgttctctgccctaattgaatttgcaactgttaattacttcaccaaaaga
ggatgggcttgggatgggaagagtgtagtaaatgacaagaaaaaagaaaaggcttccgtt
atgatacagaacaacgcttatgcagtggctgttgccaattatgccccgaatctttcaaaa
gatccagttctctccaccatctccaagagtgcaaccacgccagaacccaacaagaagcca
gaaaacaagccagctgaagcaaagaaaactttcaacagtgttagcaaaattgacagaatg
tccagaatagtttttccagttttgtttggtacctttaatttagtttactgggctacatat
ttaaacagagaacctgtattaggggtcagtccttga

KEGG   Homo sapiens (human): 2556
Entry
2556              CDS       T01001                                 

Gene name
GABRA3
Definition
(RefSeq) gamma-aminobutyric acid type A receptor subunit alpha3
  KO
K05175  gamma-aminobutyric acid receptor subunit alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04723  Retrograde endocannabinoid signaling
hsa04727  GABAergic synapse
hsa04742  Taste transduction
hsa05032  Morphine addiction
hsa05033  Nicotine addiction
Drug target
Abecarnil: D02594
Adinazolam (DG00911): D02770 D02771
Adipiplon: D08840
Alpidem: D02833
Alprazolam: D00225<JP/US>
Aminobutyric acid: D00058<JP>
Amobarbital (DG00916): D00555<JP> D02252
Aprobarbital: D00698
Barbexaclone: D07298
Barbital: D01740
Bretazenil: D03155
Brexanolone: D11149<US>
Bromazepam: D01245<JP>
Brotizolam: D01744<JP>
Butabarbital (DG01308): D00699 D03180
Butobarbital: D02618
Cenobamate: D11150<US>
Chlordiazepoxide (DG00908): D00267<JP> D00693<US>
Cinolazepam: D07328
Clobazam: D01253<JP/US>
Clonazepam: D00280<JP/US>
Clotiazepam: D01328<JP>
Cloxazolam: D01268<JP>
Delorazepam: D07784
Dextofisopam: D03737
Diazepam: D00293<JP/US>
Estazolam: D00311<JP/US>
Eszopiclone: D02624<JP/US>
Ethyl loflazepate: D01293<JP>
Etizolam: D01514<JP>
Fludiazepam: D01354<JP>
Flumazenil: D00697<JP/US>
Flunitrazepam: D01230<JP>
Flurazepam (DG00919): D00329 D00695<US> D01408<JP>
Flutazolam: D01286<JP>
Flutoprazepam: D01279<JP>
Gaboxadol: D04282
Ganaxolone: D04300
Glutethimide: D00532
Halazepam: D00338
Haloxazolam: D01758<JP>
Hexobarbital: D01071
Indiplon: D02640
Iomazenil: D02283<JP>
Ketazolam: D04650
Levotofisopam: D04721
Loprazolam (DG00921): D07326 D08145
Lorazepam: D00365<JP/US>
Lormetazepam: D01657<JP>
Medazepam (DG00909): D01292<JP> D04882
Meprobamate: D00376<US>
Metharbital: D01382
Methylphenobarbital: D00700
Mexazolam: D01316<JP>
Midazolam (DG00920): D00550<JP/US> D00696<US> D05028
Nimetazepam: D01593
Nitrazepam: D00531<JP>
Nordazepam: D08283
Ocinaplon: D02617
Oxazepam: D00464<US>
Oxazolam: D01278<JP>
Pagoclone: D02616
Panadiplon: D05346
Pazinaclone: D05378
Pentobarbital (DG00915): D00499 D00500<US> D02253<JP>
Phenobarbital (DG00845): D00506<JP> D00701<JP> D08356
Potassium clorazepate (DG01218): D00694<JP/US> D03562
Prazepam: D00470
Propofol (DG00797): D00549<JP/US> D04257
Quazepam: D00457<JP/US>
Remimazolam (DG03105): D10194<JP/US> D11788
Rilmazafone (DG01307): D01564<JP> D08481
Sarmazenil: D08507
Secobarbital (DG00917): D00430 D01310<JP/US>
Suritozole: D05980
Talbutal: D06887
Temazepam: D00370<US>
Thiamylal (DG01377): D00713<JP> D06106
Thiopental (DG00790): D00714<JP>
Tofisopam: D01254<JP>
Topiramate: D00537<JP/US>
Triazolam: D00387<JP/US>
Zolpidem (DG00922): D00706<JP/US> D08690
Zopiclone: D01372<JP>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2556 (GABRA3)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    2556 (GABRA3)
   04723 Retrograde endocannabinoid signaling
    2556 (GABRA3)
  09157 Sensory system
   04742 Taste transduction
    2556 (GABRA3)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    2556 (GABRA3)
   05033 Nicotine addiction
    2556 (GABRA3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    2556 (GABRA3)
Ion channels [BR:hsa04040]
 Ligand-gated channels
  GABA-A
   2556 (GABRA3)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Other DBs
NCBI-GeneID: 2556
NCBI-ProteinID: NP_000799
OMIM: 305660
HGNC: 4077
Ensembl: ENSG00000011677
Vega: OTTHUMG00000024183
Pharos: P34903(Tclin)
UniProt: P34903
LinkDB
Structure
PDB: 
5O8F

Position
Xq28
AA seq 492 aa
MIITQTSHCYMTSLGILFLINILPGTTGQGESRRQEPGDFVKQDIGGLSPKHAPDIPDDS
TDNITIFTRILDRLLDGYDNRLRPGLGDAVTEVKTDIYVTSFGPVSDTDMEYTIDVFFRQ
TWHDERLKFDGPMKILPLNNLLASKIWTPDTFFHNGKKSVAHNMTTPNKLLRLVDNGTLL
YTMRLTIHAECPMHLEDFPMDVHACPLKFGSYAYTTAEVVYSWTLGKNKSVEVAQDGSRL
NQYDLLGHVVGTEIIRSSTGEYVVMTTHFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLN
RESVPARTVFGVTTVLTMTTLSISARNSLPKVAYATAMDWFIAVCYAFVFSALIEFATVN
YFTKRSWAWEGKKVPEALEMKKKTPAAPAKKTSTTFNIVGTTYPINLAKDTEFSTISKGA
APSASSTPTIIASPKATYVQDSPTETKTYNSVSKVDKISRIIFPVLFAIFNLVYWATYVN
RESAIKGMIRKQ
NT seq 1479 nt   +upstreamnt  +downstreamnt
atgataatcacacaaacaagtcactgttacatgaccagccttgggattcttttcctgatt
aatattctccctggaaccactggtcaaggggaatcaagacgacaagaacccggggacttt
gtgaagcaggacattggcgggctgtctcctaagcatgccccagatattcctgatgacagc
actgacaacatcactatcttcaccagaatcttggatcgtcttctggacggctatgacaac
cggctgcgacctgggcttggagatgcagtgactgaagtgaagactgacatctacgtgacc
agttttggccctgtgtcagacactgacatggagtacactattgatgtattttttcggcag
acatggcatgatgaaagactgaaatttgatggccccatgaagatccttccactgaacaat
ctcctggctagtaagatctggacaccggacaccttcttccacaatggcaagaaatcagtg
gctcataacatgaccacgcccaacaagctgctcagattggtggacaacggaaccctcctc
tatacaatgaggttaacaattcatgctgagtgtcccatgcatttggaagattttcccatg
gatgtgcatgcctgcccactgaagtttggaagctatgcctatacaacagctgaagtggtt
tattcttggactctcggaaagaacaaatccgtggaagtggcacaggatggttctcgcttg
aaccagtatgaccttttgggccatgttgttgggacagagataatccggtctagtacagga
gaatatgtcgtcatgacaacccacttccatctcaagcgaaaaattggctactttgtgatc
cagacctacttgccatgtatcatgactgtcattctgtcacaagtgtcgttctggctcaac
agagagtctgttcctgcccgtacagtctttggtgtcaccactgtgcttaccatgaccacc
ttgagtatcagtgccagaaattccttacctaaagtggcatatgcgacggccatggactgg
ttcatagccgtctgttatgcctttgtattttctgcactgattgaatttgccactgtcaac
tatttcaccaagcggagttgggcttgggaaggcaagaaggtgccagaggccctggagatg
aagaagaaaacaccagcagccccagcaaagaaaaccagcactaccttcaacatcgtgggg
accacctatcccatcaacctggccaaggacactgaattttccaccatctccaagggcgct
gctcccagtgcctcctcaaccccaacaatcattgcttcacccaaggccacctacgtgcag
gacagcccgactgagaccaagacctacaacagtgtcagcaaggttgacaaaatttcccgc
atcatctttcctgtgctctttgccatattcaatctggtctattgggccacatatgtcaac
cgggagtcagctatcaagggcatgatccgcaaacagtag

KEGG   Homo sapiens (human): 2557
Entry
2557              CDS       T01001                                 

Gene name
GABRA4
Definition
(RefSeq) gamma-aminobutyric acid type A receptor subunit alpha4
  KO
K05175  gamma-aminobutyric acid receptor subunit alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04723  Retrograde endocannabinoid signaling
hsa04727  GABAergic synapse
hsa04742  Taste transduction
hsa05032  Morphine addiction
hsa05033  Nicotine addiction
Drug target
Abecarnil: D02594
Adinazolam (DG00911): D02770 D02771
Adipiplon: D08840
Alpidem: D02833
Alprazolam: D00225<JP/US>
Aminobutyric acid: D00058<JP>
Amobarbital (DG00916): D00555<JP> D02252
Aprobarbital: D00698
Barbexaclone: D07298
Barbital: D01740
Bretazenil: D03155
Brexanolone: D11149<US>
Bromazepam: D01245<JP>
Brotizolam: D01744<JP>
Butabarbital (DG01308): D00699 D03180
Butobarbital: D02618
Cenobamate: D11150<US>
Chlordiazepoxide (DG00908): D00267<JP> D00693<US>
Cinolazepam: D07328
Clobazam: D01253<JP/US>
Clonazepam: D00280<JP/US>
Clotiazepam: D01328<JP>
Cloxazolam: D01268<JP>
Delorazepam: D07784
Dextofisopam: D03737
Diazepam: D00293<JP/US>
Estazolam: D00311<JP/US>
Eszopiclone: D02624<JP/US>
Ethyl loflazepate: D01293<JP>
Etizolam: D01514<JP>
Fludiazepam: D01354<JP>
Flumazenil: D00697<JP/US>
Flunitrazepam: D01230<JP>
Flurazepam (DG00919): D00329 D00695<US> D01408<JP>
Flutazolam: D01286<JP>
Flutoprazepam: D01279<JP>
Gaboxadol: D04282
Ganaxolone: D04300
Glutethimide: D00532
Halazepam: D00338
Haloxazolam: D01758<JP>
Hexobarbital: D01071
Indiplon: D02640
Iomazenil: D02283<JP>
Ketazolam: D04650
Levotofisopam: D04721
Loprazolam (DG00921): D07326 D08145
Lorazepam: D00365<JP/US>
Lormetazepam: D01657<JP>
Medazepam (DG00909): D01292<JP> D04882
Meprobamate: D00376<US>
Metharbital: D01382
Methylphenobarbital: D00700
Mexazolam: D01316<JP>
Midazolam (DG00920): D00550<JP/US> D00696<US> D05028
Nimetazepam: D01593
Nitrazepam: D00531<JP>
Nordazepam: D08283
Ocinaplon: D02617
Oxazepam: D00464<US>
Oxazolam: D01278<JP>
Pagoclone: D02616
Panadiplon: D05346
Pazinaclone: D05378
Pentobarbital (DG00915): D00499 D00500<US> D02253<JP>
Phenobarbital (DG00845): D00506<JP> D00701<JP> D08356
Potassium clorazepate (DG01218): D00694<JP/US> D03562
Prazepam: D00470
Propofol (DG00797): D00549<JP/US> D04257
Quazepam: D00457<JP/US>
Remimazolam (DG03105): D10194<JP/US> D11788
Rilmazafone (DG01307): D01564<JP> D08481
Sarmazenil: D08507
Secobarbital (DG00917): D00430 D01310<JP/US>
Suritozole: D05980
Talbutal: D06887
Temazepam: D00370<US>
Thiamylal (DG01377): D00713<JP> D06106
Thiopental (DG00790): D00714<JP>
Tofisopam: D01254<JP>
Topiramate: D00537<JP/US>
Triazolam: D00387<JP/US>
Zolpidem (DG00922): D00706<JP/US> D08690
Zopiclone: D01372<JP>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2557 (GABRA4)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    2557 (GABRA4)
   04723 Retrograde endocannabinoid signaling
    2557 (GABRA4)
  09157 Sensory system
   04742 Taste transduction
    2557 (GABRA4)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    2557 (GABRA4)
   05033 Nicotine addiction
    2557 (GABRA4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    2557 (GABRA4)
Ion channels [BR:hsa04040]
 Ligand-gated channels
  GABA-A
   2557 (GABRA4)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb OAD_gamma
Other DBs
NCBI-GeneID: 2557
NCBI-ProteinID: NP_000800
OMIM: 137141
HGNC: 4078
Ensembl: ENSG00000109158
Vega: OTTHUMG00000099431
Pharos: P48169(Tclin)
UniProt: P48169 X5D7F5
LinkDB
Position
4p12
AA seq 554 aa
MVSAKKVPAIALSAGVSFALLRFLCLAVCLNESPGQNQKEEKLCTENFTRILDSLLDGYD
NRLRPGFGGPVTEVKTDIYVTSFGPVSDVEMEYTMDVFFRQTWIDKRLKYDGPIEILRLN
NMMVTKVWTPDTFFRNGKKSVSHNMTAPNKLFRIMRNGTILYTMRLTISAECPMRLVDFP
MDGHACPLKFGSYAYPKSEMIYTWTKGPEKSVEVPKESSSLVQYDLIGQTVSSETIKSIT
GEYIVMTVYFHLRRKMGYFMIQTYIPCIMTVILSQVSFWINKESVPARTVFGITTVLTMT
TLSISARHSLPKVSYATAMDWFIAVCFAFVFSALIEFAAVNYFTNIQMEKAKRKTSKPPQ
EVPAAPVQREKHPEAPLQNTNANLNMRKRTNALVHSESDVGNRTEVGNHSSKSSTVVQES
SKGTPRSYLASSPNPFSRANAAETISAARALPSASPTSIRTGYMPRKASVGSASTRHVFG
SRLQRIKTTVNTIGATGKLSATPPPSAPPPSGSGTSKIDKYARILFPVTFGAFNMVYWVV
YLSKDTMEKSESLM
NT seq 1665 nt   +upstreamnt  +downstreamnt
atggtttctgccaagaaggtacccgcgatcgctctgtccgccggggtcagtttcgccctc
ctgcgcttcctgtgcctggcggtttgtttaaacgaatccccaggacagaaccaaaaggag
gagaaattgtgcacagaaaatttcacccgcatcctggacagtttgctcgatggttatgac
aacaggctgcgtcctggatttgggggtcctgttacagaagtgaaaactgacatatatgtc
accagctttggacctgtttctgatgttgaaatggaatacacaatggatgtgttcttcagg
cagacatggattgacaaaagattaaaatatgacggccccattgaaattttgagattgaac
aatatgatggtaacgaaagtgtggacccctgatactttcttcaggaatggaaagaaatct
gtctcacataatatgacagctccaaataagctttttagaattatgagaaatggtactatt
ttatacacaatgagactcaccataagtgcggagtgtcccatgagattggtggattttccc
atggatggtcatgcatgccctttgaaattcgggagttatgcctatccaaagagtgagatg
atctatacctggacaaaaggtcctgagaaatcagttgaagttccgaaggagtcttccagc
ttagttcaatatgatttgattgggcaaaccgtatcaagtgaaaccatcaaatcaattacg
ggtgaatatattgttatgacggtttacttccacctcagacggaagatgggttattttatg
attcagacctatattccgtgcattatgacagtgattctttctcaagtttcattttggata
aataaagaatcagttcccgctaggactgtatttggaataacaactgtcctcaccatgacc
acactaagcatcagtgcacgacattctttgcccaaagtgtcctatgctaccgccatggac
tggttcatagctgtctgctttgcttttgtattttcggcccttatcgagtttgctgctgtc
aactatttcaccaatattcaaatggaaaaagccaaaaggaagacatcaaagccccctcag
gaagttcccgctgctccagtgcagagagagaagcatcctgaagcccctctgcagaataca
aatgccaatttgaacatgagaaaaagaacaaatgctttggttcactctgaatctgatgtt
ggcaacagaactgaggtgggaaaccattcaagcaaatcttccacagttgttcaagaatct
tctaaaggcacacctcggtcttacttagcttccagtccaaacccattcagccgtgcaaat
gcagctgaaaccatatctgcagcaagagcacttccatctgcttctcctacttctatccga
actggatatatgcctcgaaaggcttcagttggatctgcttctactcgtcacgtgtttgga
tcaagactgcagaggataaagaccacagttaataccataggggctactgggaagttgtca
gctactcctcctccatcggctccaccaccttctggatctggcacaagtaaaatagacaaa
tatgcccgtattctctttccagtcacatttggggcatttaacatggtttattgggttgtt
tatttatctaaggacactatggagaaatcagaaagtctaatgtaa

KEGG   Homo sapiens (human): 2558
Entry
2558              CDS       T01001                                 

Gene name
GABRA5, EIEE79
Definition
(RefSeq) gamma-aminobutyric acid type A receptor subunit alpha5
  KO
K05175  gamma-aminobutyric acid receptor subunit alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04723  Retrograde endocannabinoid signaling
hsa04727  GABAergic synapse
hsa04742  Taste transduction
hsa05032  Morphine addiction
hsa05033  Nicotine addiction
Disease
H00606  Early infantile epileptic encephalopathy
Drug target
Abecarnil: D02594
Adinazolam (DG00911): D02770 D02771
Adipiplon: D08840
Alpidem: D02833
Alprazolam: D00225<JP/US>
Aminobutyric acid: D00058<JP>
Amobarbital (DG00916): D00555<JP> D02252
Aprobarbital: D00698
Barbexaclone: D07298
Barbital: D01740
Bretazenil: D03155
Brexanolone: D11149<US>
Bromazepam: D01245<JP>
Brotizolam: D01744<JP>
Butabarbital (DG01308): D00699 D03180
Butobarbital: D02618
Cenobamate: D11150<US>
Chlordiazepoxide (DG00908): D00267<JP> D00693<US>
Cinolazepam: D07328
Clobazam: D01253<JP/US>
Clonazepam: D00280<JP/US>
Clotiazepam: D01328<JP>
Cloxazolam: D01268<JP>
Delorazepam: D07784
Dextofisopam: D03737
Diazepam: D00293<JP/US>
Estazolam: D00311<JP/US>
Eszopiclone: D02624<JP/US>
Ethyl loflazepate: D01293<JP>
Etizolam: D01514<JP>
Fludiazepam: D01354<JP>
Flumazenil: D00697<JP/US>
Flunitrazepam: D01230<JP>
Flurazepam (DG00919): D00329 D00695<US> D01408<JP>
Flutazolam: D01286<JP>
Flutoprazepam: D01279<JP>
Gaboxadol: D04282
Ganaxolone: D04300
Glutethimide: D00532
Halazepam: D00338
Haloxazolam: D01758<JP>
Hexobarbital: D01071
Indiplon: D02640
Iomazenil: D02283<JP>
Ketazolam: D04650
Levotofisopam: D04721
Loprazolam (DG00921): D07326 D08145
Lorazepam: D00365<JP/US>
Lormetazepam: D01657<JP>
Medazepam (DG00909): D01292<JP> D04882
Meprobamate: D00376<US>
Metharbital: D01382
Methylphenobarbital: D00700
Mexazolam: D01316<JP>
Midazolam (DG00920): D00550<JP/US> D00696<US> D05028
Nimetazepam: D01593
Nitrazepam: D00531<JP>
Nordazepam: D08283
Ocinaplon: D02617
Oxazepam: D00464<US>
Oxazolam: D01278<JP>
Pagoclone: D02616
Panadiplon: D05346
Pazinaclone: D05378
Pentobarbital (DG00915): D00499 D00500<US> D02253<JP>
Phenobarbital (DG00845): D00506<JP> D00701<JP> D08356
Potassium clorazepate (DG01218): D00694<JP/US> D03562
Prazepam: D00470
Propofol (DG00797): D00549<JP/US> D04257
Quazepam: D00457<JP/US>
Remimazolam (DG03105): D10194<JP/US> D11788
Rilmazafone (DG01307): D01564<JP> D08481
Sarmazenil: D08507
Secobarbital (DG00917): D00430 D01310<JP/US>
Suritozole: D05980
Talbutal: D06887
Temazepam: D00370<US>
Thiamylal (DG01377): D00713<JP> D06106
Thiopental (DG00790): D00714<JP>
Tofisopam: D01254<JP>
Topiramate: D00537<JP/US>
Triazolam: D00387<JP/US>
Zolpidem (DG00922): D00706<JP/US> D08690
Zopiclone: D01372<JP>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2558 (GABRA5)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    2558 (GABRA5)
   04723 Retrograde endocannabinoid signaling
    2558 (GABRA5)
  09157 Sensory system
   04742 Taste transduction
    2558 (GABRA5)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    2558 (GABRA5)
   05033 Nicotine addiction
    2558 (GABRA5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    2558 (GABRA5)
Ion channels [BR:hsa04040]
 Ligand-gated channels
  GABA-A
   2558 (GABRA5)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb CytochromB561_N
Other DBs
NCBI-GeneID: 2558
NCBI-ProteinID: NP_000801
OMIM: 137142
HGNC: 4079
Ensembl: ENSG00000186297
Vega: OTTHUMG00000171824
Pharos: P31644(Tclin)
UniProt: P31644
LinkDB
Structure
PDB: 
5O8F 6A96

Position
15q12
AA seq 462 aa
MDNGMFSGFIMIKNLLLFCISMNLSSHFGFSQMPTSSVKDETNDNITIFTRILDGLLDGY
DNRLRPGLGERITQVRTDIYVTSFGPVSDTEMEYTIDVFFRQSWKDERLRFKGPMQRLPL
NNLLASKIWTPDTFFHNGKKSIAHNMTTPNKLLRLEDDGTLLYTMRLTISAECPMQLEDF
PMDAHACPLKFGSYAYPNSEVVYVWTNGSTKSVVVAEDGSRLNQYHLMGQTVGTENISTS
TGEYTIMTAHFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLNRESVPARTVFGVTTVLTM
TTLSISARNSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNYFTKRGWAWDGKKALEAA
KIKKKREVILNKSTNAFTTGKMSHPPNIPKEQTPAGTSNTTSVSVKPSEEKTSESKKTYN
SISKIDKMSRIVFPVLFGTFNLVYWATYLNREPVIKGAASPK
NT seq 1389 nt   +upstreamnt  +downstreamnt
atggacaatggaatgttctctggttttatcatgatcaaaaacctccttctcttttgtatt
tccatgaacttatccagtcactttggcttttcacagatgccaaccagttcagtgaaagat
gagaccaatgacaacatcacgatatttaccaggatcttggatgggctcttggatggctac
gacaacagacttcggcccgggctgggagagcgcatcactcaggtgaggaccgacatctac
gtcaccagcttcggcccggtgtccgacacggaaatggagtacaccatagacgtgtttttc
cgacaaagctggaaagatgaaaggcttcggtttaaggggcccatgcagcgcctccctctc
aacaacctccttgccagcaagatctggaccccagacacgttcttccacaacgggaagaag
tccatcgctcacaacatgaccacgcccaacaagctgctgcggctggaggacgacggcacc
ctgctctacaccatgcgcttgaccatctctgcagagtgccccatgcagcttgaggacttc
ccgatggatgcgcacgcttgccctctgaaatttggcagctatgcgtaccctaattctgaa
gtcgtttacgtctggaccaacggctccaccaagtcggtggtggtggcggaagatggctcc
agactgaaccagtaccacctgatggggcagacggtgggcactgagaacatcagcaccagc
acaggcgaatacacaatcatgacagctcacttccacctgaaaaggaagattggctacttt
gtcatccagacctaccttccctgcataatgaccgtgatcttatcacaggtgtccttttgg
ctgaaccgggaatcagtcccagccaggacagtttttggggtcaccacggtgctgaccatg
acgaccctcagcatcagcgccaggaactctctgcccaaagtggcctacgccaccgccatg
gactggttcatagccgtgtgctatgccttcgtcttctcggcgctgatagagtttgccacg
gtcaattactttaccaagagaggctgggcctgggatggcaaaaaagccttggaagcagcc
aagatcaagaaaaagcgtgaagtcatactaaataagtcaacaaacgcttttacaactggg
aagatgtctcaccccccaaacattccgaaggaacagaccccagcagggacgtcgaataca
acctcagtctcagtaaaaccctctgaagagaagacttctgaaagcaaaaagacttacaac
agtatcagcaaaattgacaaaatgtcccgaatcgtattcccagtcttgttcggcactttc
aacttagtttactgggcaacgtatttgaatagggagccggtgataaaaggagccgcctct
ccaaaataa

KEGG   Homo sapiens (human): 2559
Entry
2559              CDS       T01001                                 

Gene name
GABRA6
Definition
(RefSeq) gamma-aminobutyric acid type A receptor subunit alpha6
  KO
K05175  gamma-aminobutyric acid receptor subunit alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04723  Retrograde endocannabinoid signaling
hsa04727  GABAergic synapse
hsa04742  Taste transduction
hsa05032  Morphine addiction
hsa05033  Nicotine addiction
Drug target
Abecarnil: D02594
Adinazolam (DG00911): D02770 D02771
Adipiplon: D08840
Alpidem: D02833
Alprazolam: D00225<JP/US>
Aminobutyric acid: D00058<JP>
Amobarbital (DG00916): D00555<JP> D02252
Aprobarbital: D00698
Barbexaclone: D07298
Barbital: D01740
Bretazenil: D03155
Brexanolone: D11149<US>
Bromazepam: D01245<JP>
Brotizolam: D01744<JP>
Butabarbital (DG01308): D00699 D03180
Butobarbital: D02618
Cenobamate: D11150<US>
Chlordiazepoxide (DG00908): D00267<JP> D00693<US>
Cinolazepam: D07328
Clobazam: D01253<JP/US>
Clonazepam: D00280<JP/US>
Clotiazepam: D01328<JP>
Cloxazolam: D01268<JP>
Delorazepam: D07784
Dextofisopam: D03737
Diazepam: D00293<JP/US>
Estazolam: D00311<JP/US>
Eszopiclone: D02624<JP/US>
Ethyl loflazepate: D01293<JP>
Etizolam: D01514<JP>
Fludiazepam: D01354<JP>
Flumazenil: D00697<JP/US>
Flunitrazepam: D01230<JP>
Flurazepam (DG00919): D00329 D00695<US> D01408<JP>
Flutazolam: D01286<JP>
Flutoprazepam: D01279<JP>
Gaboxadol: D04282
Ganaxolone: D04300
Glutethimide: D00532
Halazepam: D00338
Haloxazolam: D01758<JP>
Hexobarbital: D01071
Indiplon: D02640
Iomazenil: D02283<JP>
Ketazolam: D04650
Levotofisopam: D04721
Loprazolam (DG00921): D07326 D08145
Lorazepam: D00365<JP/US>
Lormetazepam: D01657<JP>
Medazepam (DG00909): D01292<JP> D04882
Meprobamate: D00376<US>
Metharbital: D01382
Methylphenobarbital: D00700
Mexazolam: D01316<JP>
Midazolam (DG00920): D00550<JP/US> D00696<US> D05028
Nimetazepam: D01593
Nitrazepam: D00531<JP>
Nordazepam: D08283
Ocinaplon: D02617
Oxazepam: D00464<US>
Oxazolam: D01278<JP>
Pagoclone: D02616
Panadiplon: D05346
Pazinaclone: D05378
Pentobarbital (DG00915): D00499 D00500<US> D02253<JP>
Phenobarbital (DG00845): D00506<JP> D00701<JP> D08356
Potassium clorazepate (DG01218): D00694<JP/US> D03562
Prazepam: D00470
Propofol (DG00797): D00549<JP/US> D04257
Quazepam: D00457<JP/US>
Remimazolam (DG03105): D10194<JP/US> D11788
Rilmazafone (DG01307): D01564<JP> D08481
Sarmazenil: D08507
Secobarbital (DG00917): D00430 D01310<JP/US>
Suritozole: D05980
Talbutal: D06887
Temazepam: D00370<US>
Thiamylal (DG01377): D00713<JP> D06106
Thiopental (DG00790): D00714<JP>
Tofisopam: D01254<JP>
Topiramate: D00537<JP/US>
Triazolam: D00387<JP/US>
Zolpidem (DG00922): D00706<JP/US> D08690
Zopiclone: D01372<JP>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2559 (GABRA6)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    2559 (GABRA6)
   04723 Retrograde endocannabinoid signaling
    2559 (GABRA6)
  09157 Sensory system
   04742 Taste transduction
    2559 (GABRA6)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    2559 (GABRA6)
   05033 Nicotine addiction
    2559 (GABRA6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    2559 (GABRA6)
Ion channels [BR:hsa04040]
 Ligand-gated channels
  GABA-A
   2559 (GABRA6)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb DUF4396
Other DBs
NCBI-GeneID: 2559
NCBI-ProteinID: NP_000802
OMIM: 137143
HGNC: 4080
Ensembl: ENSG00000145863
Vega: OTTHUMG00000130351
Pharos: Q16445(Tclin)
UniProt: Q16445
LinkDB
Position
5q34
AA seq 453 aa
MASSLPWLCIILWLENALGKLEVEGNFYSENVSRILDNLLEGYDNRLRPGFGGAVTEVKT
DIYVTSFGPVSDVEMEYTMDVFFRQTWTDERLKFGGPTEILSLNNLMVSKIWTPDTFFRN
GKKSIAHNMTTPNKLFRIMQNGTILYTMRLTINADCPMRLVNFPMDGHACPLKFGSYAYP
KSEIIYTWKKGPLYSVEVPEESSSLLQYDLIGQTVSSETIKSNTGEYVIMTVYFHLQRKM
GYFMIQIYTPCIMTVILSQVSFWINKESVPARTVFGITTVLTMTTLSISARHSLPKVSYA
TAMDWFIAVCFAFVFSALIEFAAVNYFTNLQTQKAKRKAQFAAPPTVTISKATEPLEAEI
VLHPDSKYHLKKRITSLSLPIVSSSEANKVLTRAPILQSTPVTPPPLSPAFGGTSKIDQY
SRILFPVAFAGFNLVYWVVYLSKDTMEVSSSVE
NT seq 1362 nt   +upstreamnt  +downstreamnt
atggcgtcgtctctgccctggctgtgcattattctgtggctagaaaatgccctagggaaa
ctcgaagttgaaggcaacttctactcagaaaacgtcagtcggatcctggacaacttgctt
gaaggctatgacaatcggctgcggccgggatttggaggtgctgtcactgaagtcaaaaca
gacatttatgtgaccagttttgggcccgtgtcagatgtggagatggagtatacgatggat
gtttttttccgccagacctggactgatgagaggttgaagtttggggggccaactgagatt
ctgagtctgaataatttgatggtcagtaaaatctggacgcctgacacctttttcagaaat
ggtaaaaagtccattgctcacaacatgacaactcctaataaactcttcagaataatgcag
aatggaaccattttatacaccatgaggcttaccatcaatgctgactgtcccatgaggctg
gttaactttcctatggatgggcatgcttgtccactcaagtttgggagctatgcttatccc
aaaagtgaaatcatatatacgtggaaaaaaggaccactttactcagtagaagtcccagaa
gaatcttcaagccttctccagtatgatctgattggacaaacagtatctagtgagacaatt
aaatctaacacaggtgaatacgttataatgacagtttacttccacttgcaaaggaagatg
ggctacttcatgatacagatatacactccttgcattatgacagtcattctttcccaggtg
tctttctggattaataaggagtccgtcccagcaagaactgtttttgggatcaccactgtt
ttaactatgaccactttgagcatcagtgcccggcactctttgccaaaagtgtcatatgcc
actgccatggattggttcatagctgtttgctttgcattcgtcttctctgcgcttatcgag
ttcgcagctgtcaactactttaccaatcttcagacacagaaggccaaaaggaaggcacag
tttgcagccccacccacagtgacaatatcaaaagctactgaacctttggaagctgagatt
gttttgcatcctgactccaaatatcatctgaagaaaaggatcacttctctgtctttgcca
atagtttcatcttccgaggccaataaagtgctcacgagagcgcccatcttacaatcaaca
cctgtcacacccccaccactctcgccagcctttggaggcaccagtaaaatagaccagtat
tctcgaattctcttcccagttgcatttgcaggattcaaccttgtgtactgggtagtttat
ctttccaaagatacaatggaagtcagtagcagtgttgaatag

DBGET integrated database retrieval system