KEGG   Homo sapiens (human): 255738
Entry
255738            CDS       T01001                                 

Gene name
PCSK9, FH3, FHCL3, HCHOLA3, LDLCQ1, NARC-1, NARC1, PC9
Definition
(RefSeq) proprotein convertase subtilisin/kexin type 9
  KO
K13050  proprotein convertase subtilisin/kexin type 9 [EC:3.4.21.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04979  Cholesterol metabolism
Network
nt06320  APOB-LDLR signaling
  Element
N00336  PCSK9-mediated LDLR degradation
N00337  Mutation-activated PCSK9 to PCSK9-mediated LDLR degradation
Disease
H00155  Familial hypercholesterolemia
Drug target
Alirocumab: D10335<JP/US>
Bococizumab: D10621
Evolocumab: D10557<JP/US>
Frovocimab: D11398
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09154 Digestive system
   04979 Cholesterol metabolism
    255738 (PCSK9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    255738 (PCSK9)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hsa03110]
    255738 (PCSK9)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     255738 (PCSK9)
Peptidases and inhibitors [BR:hsa01002]
 Serine peptidases
  Family S8: subtilisin family
   255738 (PCSK9)
Chaperones and folding catalysts [BR:hsa03110]
 Intramolecular chaperones
  Subtilisin family
   255738 (PCSK9)
SSDB
Motif
Pfam: PCSK9_C1 PCSK9_C3 PCSK9_C2 Peptidase_S8 Inhibitor_I9
Other DBs
NCBI-GeneID: 255738
NCBI-ProteinID: NP_777596
OMIM: 607786
HGNC: 20001
Ensembl: ENSG00000169174
Vega: OTTHUMG00000008136
Pharos: Q8NBP7(Tclin)
UniProt: Q8NBP7
LinkDB
Structure
PDB: 

Position
1p32.3
AA seq 692 aa
MGTVSSRRSWWPLPLLLLLLLLLGPAGARAQEDEDGDYEELVLALRSEEDGLAEAPEHGT
TATFHRCAKDPWRLPGTYVVVLKEETHLSQSERTARRLQAQAARRGYLTKILHVFHGLLP
GFLVKMSGDLLELALKLPHVDYIEEDSSVFAQSIPWNLERITPPRYRADEYQPPDGGSLV
EVYLLDTSIQSDHREIEGRVMVTDFENVPEEDGTRFHRQASKCDSHGTHLAGVVSGRDAG
VAKGASMRSLRVLNCQGKGTVSGTLIGLEFIRKSQLVQPVGPLVVLLPLAGGYSRVLNAA
CQRLARAGVVLVTAAGNFRDDACLYSPASAPEVITVGATNAQDQPVTLGTLGTNFGRCVD
LFAPGEDIIGASSDCSTCFVSQSGTSQAAAHVAGIAAMMLSAEPELTLAELRQRLIHFSA
KDVINEAWFPEDQRVLTPNLVAALPPSTHGAGWQLFCRTVWSAHSGPTRMATAVARCAPD
EELLSCSSFSRSGKRRGERMEAQGGKLVCRAHNAFGGEGVYAIARCCLLPQANCSVHTAP
PAEASMGTRVHCHQQGHVLTGCSSHWEVEDLGTHKPPVLRPRGQPNQCVGHREASIHASC
CHAPGLECKVKEHGIPAPQEQVTVACEEGWTLTGCSALPGTSHVLGAYAVDNTCVVRSRD
VSTTGSTSEGAVTAVAICCRSRHLAQASQELQ
NT seq 2079 nt   +upstreamnt  +downstreamnt
atgggcaccgtcagctccaggcggtcctggtggccgctgccactgctgctgctgctgctg
ctgctcctgggtcccgcgggcgcccgtgcgcaggaggacgaggacggcgactacgaggag
ctggtgctagccttgcgttccgaggaggacggcctggccgaagcacccgagcacggaacc
acagccaccttccaccgctgcgccaaggatccgtggaggttgcctggcacctacgtggtg
gtgctgaaggaggagacccacctctcgcagtcagagcgcactgcccgccgcctgcaggcc
caggctgcccgccggggatacctcaccaagatcctgcatgtcttccatggccttcttcct
ggcttcctggtgaagatgagtggcgacctgctggagctggccttgaagttgccccatgtc
gactacatcgaggaggactcctctgtctttgcccagagcatcccgtggaacctggagcgg
attacccctccacggtaccgggcggatgaataccagccccccgacggaggcagcctggtg
gaggtgtatctcctagacaccagcatacagagtgaccaccgggaaatcgagggcagggtc
atggtcaccgacttcgagaatgtgcccgaggaggacgggacccgcttccacagacaggcc
agcaagtgtgacagtcatggcacccacctggcaggggtggtcagcggccgggatgccggc
gtggccaagggtgccagcatgcgcagcctgcgcgtgctcaactgccaagggaagggcacg
gttagcggcaccctcataggcctggagtttattcggaaaagccagctggtccagcctgtg
gggccactggtggtgctgctgcccctggcgggtgggtacagccgcgtcctcaacgccgcc
tgccagcgcctggcgagggctggggtcgtgctggtcaccgctgccggcaacttccgggac
gatgcctgcctctactccccagcctcagctcccgaggtcatcacagttggggccaccaat
gcccaagaccagccggtgaccctggggactttggggaccaactttggccgctgtgtggac
ctctttgccccaggggaggacatcattggtgcctccagcgactgcagcacctgctttgtg
tcacagagtgggacatcacaggctgctgcccacgtggctggcattgcagccatgatgctg
tctgccgagccggagctcaccctggccgagttgaggcagagactgatccacttctctgcc
aaagatgtcatcaatgaggcctggttccctgaggaccagcgggtactgacccccaacctg
gtggccgccctgccccccagcacccatggggcaggttggcagctgttttgcaggactgta
tggtcagcacactcggggcctacacggatggccacagccgtcgcccgctgcgccccagat
gaggagctgctgagctgctccagtttctccaggagtgggaagcggcggggcgagcgcatg
gaggcccaagggggcaagctggtctgccgggcccacaacgcttttgggggtgagggtgtc
tacgccattgccaggtgctgcctgctaccccaggccaactgcagcgtccacacagctcca
ccagctgaggccagcatggggacccgtgtccactgccaccaacagggccacgtcctcaca
ggctgcagctcccactgggaggtggaggaccttggcacccacaagccgcctgtgctgagg
ccacgaggtcagcccaaccagtgcgtgggccacagggaggccagcatccacgcttcctgc
tgccatgccccaggtctggaatgcaaagtcaaggagcatggaatcccggcccctcaggag
caggtgaccgtggcctgcgaggagggctggaccctgactggctgcagtgccctccctggg
acctcccacgtcctgggggcctacgccgtagacaacacgtgtgtagtcaggagccgggac
gtcagcactacaggcagcaccagcgaaggggccgtgacagccgttgccatctgctgccgg
agccggcacctggcgcaggcctcccaggagctccagtga

DBGET integrated database retrieval system