KEGG   Homo sapiens (human): 2567
Entry
2567              CDS       T01001                                 

Gene name
GABRG3
Definition
(RefSeq) gamma-aminobutyric acid type A receptor subunit gamma3
  KO
K05186  gamma-aminobutyric acid receptor subunit gamma
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04723  Retrograde endocannabinoid signaling
hsa04727  GABAergic synapse
hsa05032  Morphine addiction
hsa05033  Nicotine addiction
Drug target
Abecarnil: D02594
Adinazolam (DG00911): D02770 D02771
Adipiplon: D08840
Alpidem: D02833
Alprazolam: D00225<JP/US>
Aminobutyric acid: D00058<JP>
Amobarbital (DG00916): D00555<JP> D02252
Aprobarbital: D00698
Barbexaclone: D07298
Barbital: D01740
Bretazenil: D03155
Brexanolone: D11149<US>
Bromazepam: D01245<JP>
Brotizolam: D01744<JP>
Butabarbital (DG01308): D00699 D03180
Butobarbital: D02618
Cenobamate: D11150<US>
Chlordiazepoxide (DG00908): D00267<JP> D00693<US>
Cinolazepam: D07328
Clobazam: D01253<JP/US>
Clonazepam: D00280<JP/US>
Clotiazepam: D01328<JP>
Cloxazolam: D01268<JP>
Delorazepam: D07784
Dextofisopam: D03737
Diazepam: D00293<JP/US>
Estazolam: D00311<JP/US>
Eszopiclone: D02624<JP/US>
Ethyl loflazepate: D01293<JP>
Etizolam: D01514<JP>
Fludiazepam: D01354<JP>
Flumazenil: D00697<JP/US>
Flunitrazepam: D01230<JP>
Flurazepam (DG00919): D00329 D00695<US> D01408<JP>
Flutazolam: D01286<JP>
Flutoprazepam: D01279<JP>
Gaboxadol: D04282
Ganaxolone: D04300
Glutethimide: D00532
Halazepam: D00338
Haloxazolam: D01758<JP>
Hexobarbital: D01071
Indiplon: D02640
Iomazenil: D02283<JP>
Ketazolam: D04650
Levotofisopam: D04721
Loprazolam (DG00921): D07326 D08145
Lorazepam: D00365<JP/US>
Lormetazepam: D01657<JP>
Medazepam (DG00909): D01292<JP> D04882
Meprobamate: D00376<US>
Metharbital: D01382
Methylphenobarbital: D00700
Mexazolam: D01316<JP>
Midazolam (DG00920): D00550<JP/US> D00696<US> D05028
Nimetazepam: D01593
Nitrazepam: D00531<JP>
Nordazepam: D08283
Ocinaplon: D02617
Oxazepam: D00464<US>
Oxazolam: D01278<JP>
Pagoclone: D02616
Panadiplon: D05346
Pazinaclone: D05378
Pentobarbital (DG00915): D00499 D00500<US> D02253<JP>
Phenobarbital (DG00845): D00506<JP> D00701<JP> D08356
Potassium clorazepate (DG01218): D00694<JP/US> D03562
Prazepam: D00470
Propofol (DG00797): D00549<JP/US> D04257
Quazepam: D00457<JP/US>
Remimazolam (DG03105): D10194<JP/US> D11788
Rilmazafone (DG01307): D01564<JP> D08481
Sarmazenil: D08507
Secobarbital (DG00917): D00430 D01310<JP/US>
Suritozole: D05980
Talbutal: D06887
Temazepam: D00370<US>
Thiamylal (DG01377): D00713<JP> D06106
Thiopental (DG00790): D00714<JP>
Tofisopam: D01254<JP>
Topiramate: D00537<JP/US>
Triazolam: D00387<JP/US>
Zolpidem (DG00922): D00706<JP/US> D08690
Zopiclone: D01372<JP>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2567 (GABRG3)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    2567 (GABRG3)
   04723 Retrograde endocannabinoid signaling
    2567 (GABRG3)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    2567 (GABRG3)
   05033 Nicotine addiction
    2567 (GABRG3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    2567 (GABRG3)
Ion channels [BR:hsa04040]
 Ligand-gated channels
  GABA-A
   2567 (GABRG3)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Other DBs
NCBI-GeneID: 2567
NCBI-ProteinID: NP_150092
OMIM: 600233
HGNC: 4088
Ensembl: ENSG00000182256
Vega: OTTHUMG00000044462
Pharos: Q99928(Tclin)
UniProt: Q99928
LinkDB
Position
15q12
AA seq 467 aa
MAPKLLLLLCLFSGLHARSRKVEEDEYEDSSSNQKWVLAPKSQDTDVTLILNKLLREYDK
KLRPDIGIKPTVIDVDIYVNSIGPVSSINMEYQIDIFFAQTWTDSRLRFNSTMKILTLNS
NMVGLIWIPDTIFRNSKTAEAHWITTPNQLLRIWNDGKILYTLRLTINAECQLQLHNFPM
DEHSCPLIFSSYGYPKEEMIYRWRKNSVEAADQKSWRLYQFDFMGLRNTTEIVTTSAGDY
VVMTIYFELSRRMGYFTIQTYIPCILTVVLSWVSFWIKKDATPARTALGITTVLTMTTLS
TIARKSLPRVSYVTAMDLFVTVCFLFVFAALMEYATLNYYSSCRKPTTTKKTTSLLHPDS
SRWIPERISLQAPSNYSLLDMRPPPTAMITLNNSVYWQEFEDTCVYECLDGKDCQSFFCC
YEECKSGSWRKGRIHIDILELDSYSRVFFPTSFLLFNLVYWVGYLYL
NT seq 1404 nt   +upstreamnt  +downstreamnt
atggccccgaagctgctgctcctcctctgcctgttctcgggcttgcacgcgcggtccaga
aaggtggaagaggatgaatatgaagattcatcatcaaaccaaaagtgggtcttggctcca
aaatcccaagacaccgacgtgactcttattctcaacaagttgctaagagaatatgataaa
aagctgaggccagatattggaataaaaccgaccgtaattgacgttgacatttatgttaac
agcattggtcctgtgtcatcaataaacatggaataccaaattgacatattttttgctcag
acctggacagatagtcgccttcgattcaacagcacaatgaaaattcttactctgaacagc
aacatggtggggttaatctggatcccagacaccatcttccgcaattctaaaaccgcagag
gctcactggatcaccacacccaatcagctcctccggatttggaatgacgggaaaatcctt
tacactttgaggctcaccatcaatgctgagtgccagctgcagctgcacaacttccccatg
gacgaacactcctgcccgctgattttctccagctatggctatcccaaagaagaaatgatt
tatagatggagaaaaaattcagtggaggcagctgaccagaaatcatggcggctttatcag
tttgacttcatgggcctcagaaacaccacagaaatcgtgacaacgtctgcaggtgattat
gttgtcatgactatatattttgaattgagtagaagaatgggatacttcaccattcagaca
tacattccctgtatactgactgtggttttatcctgggtgtcattttggatcaaaaaagat
gctacgccagcaagaacagcattaggcatcaccacggtgctgaccatgaccaccctgagc
accatcgccaggaagtccttgccacgcgtgtcctacgtgaccgccatggacctttttgtg
accgtgtgcttcctgtttgtcttcgccgcgctgatggagtatgccaccctcaactactat
tccagctgtagaaaaccaaccaccacgaagaagacaacatcgttactacatccagattcc
tcaagatggattcctgagcgaataagcctacaagccccttccaactattccctcctggac
atgaggccaccaccaactgcgatgatcactttaaacaattccgtttactggcaggaattt
gaagatacctgtgtctatgagtgtctggatggcaaagactgtcagagcttcttctgctgc
tatgaagaatgtaaatcaggatcctggaggaaagggcgtattcacatagacatcttggag
ctggactcgtactcccgggtctttttccccacgtccttcctgctctttaacctggtctac
tgggttggatacctgtatctctaa

DBGET integrated database retrieval system