KEGG   Homo sapiens (human): 256933Help
Entry
256933            CDS       T01001                                 

Gene name
NPB, L7, PPL7, PPNPB
Definition
(RefSeq) neuropeptide B
  KO
K05267  preproneuropeptide B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    256933 (NPB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NPBW
Motif
Other DBs
NCBI-GeneID: 256933
NCBI-ProteinID: NP_683694
OMIM: 607996
HGNC: 30099
Ensembl: ENSG00000183979
Vega: OTTHUMG00000177983
Pharos: Q8NG41(Tdark)
CPD: C16035 C16034
UniProt: Q8NG41
LinkDB All DBs
Position
17q25.3
AA seq 125 aa AA seqDB search
MARSATLAAAALALCLLLAPPGLAWYKPAAGHSSYSVGRAAGLLSGLRRSPYARRSQPYR
GAEPPGGAGASPELQLHPRLRSLAVCVQDVAPNLQRCERLPDGRGTYQCKANVFLSLRAA
DCLAA
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atggcccggtccgcgacactggcggccgccgccctggcgctgtgcctgctgctggcgccg
cctggcctcgcgtggtacaagccagcggcggggcacagctcctactcggtgggccgcgcc
gcggggctgctgtccggcctccgcaggtccccgtacgcgcggcgctcccagccctacaga
ggggcggaacccccgggcggggccggcgcctccccggagctgcaactgcaccccaggctg
cggagcctcgctgtgtgcgtccaggacgtcgccccaaacctgcagaggtgcgagcggctc
cccgacggccgcgggacctaccagtgcaaggcgaacgtcttcctgtccctgcgcgcagcc
gactgcctcgccgcctga

KEGG   Homo sapiens (human): 283869Help
Entry
283869            CDS       T01001                                 

Gene name
NPW, L8, L8C, PPL8, PPNPW
Definition
(RefSeq) neuropeptide W
  KO
K23141  neuropeptide W
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    283869 (NPW)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NPBW
Motif
Other DBs
NCBI-GeneID: 283869
NCBI-ProteinID: NP_001092926
OMIM: 607997
HGNC: 30509
Ensembl: ENSG00000183971
Pharos: Q8N729(Tbio)
CPD: C16032 C16033
UniProt: Q8N729
LinkDB All DBs
Position
16p13.3
AA seq 165 aa AA seqDB search
MAWRPGERGAPASRPRLALLLLLLLLPLPSGAWYKHVASPRYHTVGRAAGLLMGLRRSPY
LWRRALRAAAGPLARDTLSPEPAAREAPLLLPSWVQELWETRRRSSQAGIPVRAPRSPRA
PEPALEPESLDFSGAGQRLRRDVSRPAVDPAANRLGLPCLAPGPF
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
ctggcgtggcgcccaggggagcggggggctcccgcgagccggccgcggctggcactgctg
ctgcttctgctcctgctgccgctgccctccggcgcgtggtacaagcacgtggcgagtccc
cgctaccacacggtgggccgcgccgctggcctgctcatggggctgcgtcgctcaccctat
ctgtggcgccgcgcgctgcgcgcggccgccgggcccctggccagggacaccctctccccc
gaacccgcagcccgcgaggctcctctcctgctgccctcgtgggttcaggagctgtgggag
acgcgacgcaggagctcccaggcagggatccccgtccgtgcgccccggagcccgcgcgcc
ccagagcctgcgctggaaccggagtccctggacttcagcggagctggccagagacttcgg
agagacgtctcccgcccagcggtggaccccgcagcaaaccgccttggcctgccctgcctg
gcccccggaccgttctga

DBGET integrated database retrieval system