KEGG   Homo sapiens (human): 257
Entry
257               CDS       T01001                                 

Gene name
ALX3, FND, FND1
Definition
(RefSeq) ALX homeobox 3
  KO
K09323  homeobox protein aristaless-like 3
Organism
hsa  Homo sapiens (human)
Disease
H00528  Frontonasal dysplasia
H00850  Frontorhiny
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    257 (ALX3)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, Prd
    257 (ALX3)
SSDB
Motif
Pfam: Homeodomain Homeobox_KN
Other DBs
NCBI-GeneID: 257
NCBI-ProteinID: NP_006483
OMIM: 606014
HGNC: 449
Ensembl: ENSG00000156150
Vega: OTTHUMG00000011650
Pharos: O95076(Tbio)
UniProt: O95076
LinkDB
Position
1p13.3
AA seq 343 aa
MDPEHCAPFRVGPAPGPYVASGDEPPGPQGTPAAAPHLHPAPPRGPRLTRFPACGPLEPY
LPEPAKPPAKYLQDLGPGPALNGGHFYEGPAEAEEKTSKAASFPQLPLDCRGGPRDGPSN
LQGSPGPCLASLHLPLSPGLPDSMELAKNKSKKRRNRTTFSTFQLEELEKVFQKTHYPDV
YAREQLALRTDLTEARVQVWFQNRRAKWRKRERYGKIQEGRNPFTAAYDISVLPRTDSHP
QLQNSLWASPGSGSPGGPCLVSPEGIPSPCMSPYSHPHGSVAGFMGVPAPSAAHPGIYSI
HGFPPTLGGHSFEPSSDGDYKSPSLVSLRVKPKEPPGLLNWTT
NT seq 1032 nt   +upstreamnt  +downstreamnt
atggaccccgagcactgcgcgcctttccgcgtggggcctgcacccggcccctatgtggcc
tcgggggacgagcctccgggcccgcagggaacccccgccgctgcgcctcacctgcacccc
gcgccgccccgcggcccgcggctgacccgctttccggcctgcgggcccctggagccctac
ctcccagagccggccaagccgcccgccaagtacctgcaggacctcgggcccggcccggcc
ctcaacggcggccacttctacgagggccccgcggaagctgaggagaagacctccaaagct
gccagcttcccccagctgcccttggactgccgagggggccccagagacgggccctctaac
ttgcaaggctccccaggcccctgcctggccagcctgcatcttcctctttccccgggactc
cctgactccatggagttggccaagaacaagagcaagaagcgtcgtaaccgcacgaccttc
agcacattccagctggaggagctggagaaggtcttccagaaaacccactatcctgatgtg
tatgcccgggagcagctggccctgcgcacagacctgactgaggcccgggtacaggtctgg
ttccagaaccgcagagccaagtggcggaagcgcgagcgttatgggaagatccaggagggg
cggaaccccttcacggctgcctatgacatctctgtgctgccccgtactgacagccaccct
cagctgcagaactccctgtgggccagtccaggatctgggagccctggaggcccctgcctt
gtgtctccagagggcatcccctccccatgcatgtctccatattcccacccccatgggagt
gtggctggcttcatgggggtgccagccccttctgcggctcaccctggcatctactccatc
catggctttccccccaccctggggggccacagctttgagccttcctcagatggtgactat
aagtctccaagcctcgtctcgctcagggtaaagcccaaggagccacccggccttctgaac
tggaccacgtga

DBGET integrated database retrieval system