KEGG   Homo sapiens (human): 257202
Entry
257202            CDS       T01001                                 

Gene name
GPX6, GPX5p, GPXP3, GPx-6, GSHPx-6, dJ1186N24, dJ1186N24.1
Definition
(RefSeq) glutathione peroxidase 6
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00480  Glutathione metabolism
hsa00590  Arachidonic acid metabolism
hsa01100  Metabolic pathways
hsa04918  Thyroid hormone synthesis
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05022  Pathways of neurodegeneration - multiple diseases
Network
nt06026  Glutathione biosynthesis
  Element
N00899  Glutathione biosynthesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    257202 (GPX6)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    257202 (GPX6)
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    257202 (GPX6)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    257202 (GPX6)
   05016 Huntington disease
    257202 (GPX6)
   05022 Pathways of neurodegeneration - multiple diseases
    257202 (GPX6)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     257202 (GPX6)
SSDB
Motif
Pfam: GSHPx
Other DBs
NCBI-GeneID: 257202
NCBI-ProteinID: NP_874360
OMIM: 607913
HGNC: 4558
Ensembl: ENSG00000198704
Vega: OTTHUMG00000044828
Pharos: P59796(Tdark)
UniProt: P59796
LinkDB
Position
6p22.1
AA seq 221 aa
MFQQFQASCLVLFFLVGFAQQTLKPQNRKVDCNKGVTGTIYEYGALTLNGEEYIQFKQFA
GKHVLFVNVAAYUGLAAQYPELNALQEELKNFGVIVLAFPCNQFGKQEPGTNSEILLGLK
YVCPGSGFVPSFQLFEKGDVNGEKEQKVFTFLKNSCPPTSDLLGSSSQLFWEPMKVHDIR
WNFEKFLVGPDGVPVMHWFHQAPVSTVKSDILEYLKQFNTH
NT seq 666 nt   +upstreamnt  +downstreamnt
atgttccagcagttccaggcctcctgtcttgtcctgtttttcctggttggctttgctcag
cagaccctaaagcctcaaaataggaaggtggattgcaacaaaggggtaacaggcaccatc
tatgagtatggagccctcaccctcaacggcgaggagtacatccaattcaagcagtttgca
ggcaagcacgtcctgtttgtcaatgtggccgcctattgaggcttggcagctcagtatcct
gaactgaatgcactacaggaggagctgaagaattttggtgtcattgtgttggcctttccc
tgcaaccagtttggaaaacaagaaccaggaacaaactcagaaatacttcttggtctcaag
tatgtgtgtccaggtagtggctttgtccccagtttccagctctttgagaaaggggatgtg
aatggagaaaaagaacagaaggtctttactttcctgaagaactcctgccctccgacctct
gatcttttgggctcatcaagccaactcttctgggagcccatgaaggtccatgatatccgc
tggaactttgagaaatttctggtggggcccgatggagtccctgtcatgcattggttccac
caggctccagtcagcacagtcaagtcagacatcctggagtacctaaagcagttcaatacc
cactag

KEGG   Homo sapiens (human): 2876
Entry
2876              CDS       T01001                                 

Gene name
GPX1, GPXD, GSHPX1
Definition
(RefSeq) glutathione peroxidase 1
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00480  Glutathione metabolism
hsa00590  Arachidonic acid metabolism
hsa01100  Metabolic pathways
hsa04918  Thyroid hormone synthesis
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05022  Pathways of neurodegeneration - multiple diseases
Network
nt06026  Glutathione biosynthesis
  Element
N00899  Glutathione biosynthesis
N00900  GPX1 deficiency in glutathione biosynthesis
Disease
H00668  Anemia due to disorders of glutathione metabolism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    2876 (GPX1)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    2876 (GPX1)
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    2876 (GPX1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    2876 (GPX1)
   05016 Huntington disease
    2876 (GPX1)
   05022 Pathways of neurodegeneration - multiple diseases
    2876 (GPX1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     2876 (GPX1)
SSDB
Motif
Pfam: GSHPx Redoxin AhpC-TSA
Other DBs
NCBI-GeneID: 2876
NCBI-ProteinID: NP_000572
OMIM: 138320
HGNC: 4553
Ensembl: ENSG00000233276
Vega: OTTHUMG00000156837
Pharos: P07203(Tbio)
UniProt: P07203 Q7L4Q3
LinkDB
Structure
PDB: 
2F8A

Position
3p21.31
AA seq 203 aa
MCAARLAAAAAAAQSVYAFSARPLAGGEPVSLGSLRGKVLLIENVASLUGTTVRDYTQMN
ELQRRLGPRGLVVLGFPCNQFGHQENAKNEEILNSLKYVRPGGGFEPNFMLFEKCEVNGA
GAHPLFAFLREALPAPSDDATALMTDPKLITWSPVCRNDVAWNFEKFLVGPDGVPLRRYS
RRFQTIDIEPDIEALLSQGPSCA
NT seq 612 nt   +upstreamnt  +downstreamnt
atgtgtgctgctcggctagcggcggcggcggcggcggcccagtcggtgtatgccttctcg
gcgcgcccgctggccggcggggagcctgtgagcctgggctccctgcggggcaaggtacta
cttatcgagaatgtggcgtccctctgaggcaccacggtccgggactacacccagatgaac
gagctgcagcggcgcctcggaccccggggcctggtggtgctcggcttcccgtgcaaccag
tttgggcatcaggagaacgccaagaacgaagagattctgaattccctcaagtacgtccgg
cctggtggtgggttcgagcccaacttcatgctcttcgagaagtgcgaggtgaacggtgcg
ggggcgcaccctctcttcgccttcctgcgggaggccctgccagctcccagcgacgacgcc
accgcgcttatgaccgaccccaagctcatcacctggtctccggtgtgtcgcaacgatgtt
gcctggaactttgagaagttcctggtgggccctgacggtgtgcccctacgcaggtacagc
cgccgcttccagaccattgacatcgagcctgacatcgaagccctgctgtctcaagggccc
agctgtgcctag

KEGG   Homo sapiens (human): 2877
Entry
2877              CDS       T01001                                 

Gene name
GPX2, GI-GPx, GPRP, GPRP-2, GPx-2, GPx-GI, GSHPX-GI, GSHPx-2
Definition
(RefSeq) glutathione peroxidase 2
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00480  Glutathione metabolism
hsa00590  Arachidonic acid metabolism
hsa01100  Metabolic pathways
hsa04918  Thyroid hormone synthesis
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05022  Pathways of neurodegeneration - multiple diseases
Network
nt06026  Glutathione biosynthesis
  Element
N00899  Glutathione biosynthesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    2877 (GPX2)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    2877 (GPX2)
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    2877 (GPX2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    2877 (GPX2)
   05016 Huntington disease
    2877 (GPX2)
   05022 Pathways of neurodegeneration - multiple diseases
    2877 (GPX2)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     2877 (GPX2)
SSDB
Motif
Pfam: GSHPx
Other DBs
NCBI-GeneID: 2877
NCBI-ProteinID: NP_002074
OMIM: 138319
HGNC: 4554
Ensembl: ENSG00000176153
Vega: OTTHUMG00000171677
Pharos: P18283(Tbio)
UniProt: P18283
LinkDB
Structure
PDB: 
2HE3

Position
14q23.3
AA seq 190 aa
MAFIAKSFYDLSAISLDGEKVDFNTFRGRAVLIENVASLUGTTTRDFTQLNELQCRFPRR
LVVLGFPCNQFGHQENCQNEEILNSLKYVRPGGGYQPTFTLVQKCEVNGQNEHPVFAYLK
DKLPYPYDDPFSLMTDPKLIIWSPVRRSDVAWNFEKFLIGPEGEPFRRYSRTFPTINIEP
DIKRLLKVAI
NT seq 573 nt   +upstreamnt  +downstreamnt
atggctttcattgccaagtccttctatgacctcagtgccatcagcctggatggggagaag
gtagatttcaatacgttccggggcagggccgtgctgattgagaatgtggcttcgctctga
ggcacaaccacccgggacttcacccagctcaacgagctgcaatgccgctttcccaggcgc
ctggtggtccttggcttcccttgcaaccaatttggacatcaggagaactgtcagaatgag
gagatcctgaacagtctcaagtatgtccgtcctgggggtggataccagcccaccttcacc
cttgtccaaaaatgtgaggtgaatgggcagaacgagcatcctgtcttcgcctacctgaag
gacaagctcccctacccttatgatgacccattttccctcatgaccgatcccaagctcatc
atttggagccctgtgcgccgctcagatgtggcctggaactttgagaagttcctcataggg
ccggagggagagcccttccgacgctacagccgcaccttcccaaccatcaacattgagcct
gacatcaagcgcctccttaaagttgccatatag

KEGG   Homo sapiens (human): 2878
Entry
2878              CDS       T01001                                 

Gene name
GPX3, GPx-P, GSHPx-3, GSHPx-P
Definition
(RefSeq) glutathione peroxidase 3
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00480  Glutathione metabolism
hsa00590  Arachidonic acid metabolism
hsa01100  Metabolic pathways
hsa04918  Thyroid hormone synthesis
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05022  Pathways of neurodegeneration - multiple diseases
Network
nt06026  Glutathione biosynthesis
  Element
N00899  Glutathione biosynthesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    2878 (GPX3)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    2878 (GPX3)
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    2878 (GPX3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    2878 (GPX3)
   05016 Huntington disease
    2878 (GPX3)
   05022 Pathways of neurodegeneration - multiple diseases
    2878 (GPX3)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     2878 (GPX3)
SSDB
Motif
Pfam: GSHPx
Other DBs
NCBI-GeneID: 2878
NCBI-ProteinID: NP_002075
OMIM: 138321
HGNC: 4555
Ensembl: ENSG00000211445
Vega: OTTHUMG00000163693
Pharos: P22352(Tbio)
UniProt: P22352
LinkDB
Structure
PDB: 
2R37

Position
5q33.1
AA seq 226 aa
MARLLQASCLLSLLLAGFVSQSRGQEKSKMDCHGGISGTIYEYGALTIDGEEYIPFKQYA
GKYVLFVNVASYUGLTGQYIELNALQEELAPFGLVILGFPCNQFGKQEPGENSEILPTLK
YVRPGGGFVPNFQLFEKGDVNGEKEQKFYTFLKNSCPPTSELLGTSDRLFWEPMKVHDIR
WNFEKFLVGPDGIPIMRWHHRTTVSNVKMDILSYMRRQAALGVKRK
NT seq 681 nt   +upstreamnt  +downstreamnt
atggcccggctgctgcaggcgtcctgcctgctttccctgctcctggccggcttcgtctcg
cagagccggggacaagagaagtcgaagatggactgccatggtggcataagtggcaccatt
tacgagtacggagccctcaccattgatggggaggagtacatccccttcaagcagtatgct
ggcaaatacgtcctctttgtcaacgtggccagctactgaggcctgacgggccagtacatt
gaactgaatgcactacaggaagagcttgcaccattcggtctggtcattctgggctttccc
tgcaaccaatttggaaaacaggaaccaggagagaactcagagatccttcctaccctcaag
tatgtccgaccaggtggaggctttgtccctaatttccagctctttgagaaaggggatgtc
aatggagagaaagagcagaaattctacactttcctaaagaactcctgtcctcccacctcg
gagctcctgggtacatctgaccgcctcttctgggaacccatgaaggttcacgacatccgc
tggaactttgagaagttcctggtggggccagatggtatacccatcatgcgctggcaccac
cggaccacggtcagcaacgtcaagatggacatcctgtcctacatgaggcggcaggcagcc
ctgggggtcaagaggaagtaa

KEGG   Homo sapiens (human): 2880
Entry
2880              CDS       T01001                                 

Gene name
GPX5, EGLP, GPx-5, GSHPx-5, HEL-S-75p
Definition
(RefSeq) glutathione peroxidase 5
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00480  Glutathione metabolism
hsa00590  Arachidonic acid metabolism
hsa01100  Metabolic pathways
hsa04918  Thyroid hormone synthesis
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05022  Pathways of neurodegeneration - multiple diseases
Network
nt06026  Glutathione biosynthesis
  Element
N00899  Glutathione biosynthesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    2880 (GPX5)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    2880 (GPX5)
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    2880 (GPX5)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    2880 (GPX5)
   05016 Huntington disease
    2880 (GPX5)
   05022 Pathways of neurodegeneration - multiple diseases
    2880 (GPX5)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     2880 (GPX5)
SSDB
Motif
Pfam: GSHPx
Other DBs
NCBI-GeneID: 2880
NCBI-ProteinID: NP_001500
OMIM: 603435
HGNC: 4557
Ensembl: ENSG00000224586
Vega: OTTHUMG00000016307
Pharos: O75715(Tbio)
UniProt: O75715 V9HWN8
LinkDB
Structure
PDB: 
2I3Y

Position
6p22.1
AA seq 221 aa
MTTQLRVVHLLPLLLACFVQTSPKQEKMKMDCHKDEKGTIYDYEAIALNKNEYVSFKQYV
GKHILFVNVATYCGLTAQYPELNALQEELKPYGLVVLGFPCNQFGKQEPGDNKEILPGLK
YVRPGGGFVPSFQLFEKGDVNGEKEQKVFSFLKHSCPHPSEILGTFKSISWDPVKVHDIR
WNFEKFLVGPDGIPVMRWSHRATVSSVKTDILAYLKQFKTK
NT seq 666 nt   +upstreamnt  +downstreamnt
atgactacacagttaagggtcgtccatctgcttccccttctcctagcctgctttgtgcaa
acaagtcccaagcaggagaagatgaagatggattgccacaaagacgagaaaggcaccatc
tatgactatgaggccatcgcacttaataagaatgaatatgtttccttcaagcagtatgtg
ggcaagcacatcctcttcgtcaacgtggccacctactgtggtctgacagcgcaatatcct
gaactaaatgcactccaggaggagctgaagccctatggtctagttgtgttgggctttccc
tgcaaccaatttggaaagcaagaaccaggagataacaaagagattcttcctgggctcaag
tatgtccgtccagggggaggatttgtacctagtttccagctttttgagaaaggggatgtg
aatggtgaaaaagaacagaaagtcttcagtttcttgaagcactcctgtcctcatccctct
gagattttgggcacattcaaatctatatcctgggaccctgtaaaggtccatgacatccgt
tggaactttgaaaagttcctggtggggcctgatggaatccctgtcatgcgctggtcccac
cgggctacggtcagctcagtcaagacagacatcctggcgtacttgaagcaattcaaaacc
aaatag

KEGG   Homo sapiens (human): 2882
Entry
2882              CDS       T01001                                 

Gene name
GPX7, CL683, GPX6, GPx-7, GSHPx-7, NPGPx
Definition
(RefSeq) glutathione peroxidase 7
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00480  Glutathione metabolism
hsa00590  Arachidonic acid metabolism
hsa01100  Metabolic pathways
hsa04918  Thyroid hormone synthesis
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05022  Pathways of neurodegeneration - multiple diseases
Network
nt06026  Glutathione biosynthesis
  Element
N00899  Glutathione biosynthesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    2882 (GPX7)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    2882 (GPX7)
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    2882 (GPX7)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    2882 (GPX7)
   05016 Huntington disease
    2882 (GPX7)
   05022 Pathways of neurodegeneration - multiple diseases
    2882 (GPX7)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     2882 (GPX7)
SSDB
Motif
Pfam: GSHPx AhpC-TSA Acyl-CoA_dh_C Redoxin
Other DBs
NCBI-GeneID: 2882
NCBI-ProteinID: NP_056511
OMIM: 615784
HGNC: 4559
Ensembl: ENSG00000116157
Vega: OTTHUMG00000008322
Pharos: Q96SL4(Tbio)
UniProt: Q96SL4
LinkDB
Structure
PDB: 
2P31

Position
1p32.3
AA seq 187 aa
MVAATVAAAWLLLWAAACAQQEQDFYDFKAVNIRGKLVSLEKYRGSVSLVVNVASECGFT
DQHYRALQQLQRDLGPHHFNVLAFPCNQFGQQEPDSNKEIESFARRTYSVSFPMFSKIAV
TGTGAHPAFKYLAQTSGKEPTWNFWKYLVAPDGKVVGAWDPTVSVEEVRPQITALVRKLI
LLKREDL
NT seq 564 nt   +upstreamnt  +downstreamnt
atggtggcggcgacggtggcagcggcgtggctgctcctgtgggctgcggcctgcgcgcag
caggagcaggacttctacgacttcaaggcggtcaacatccggggcaaactggtgtcgctg
gagaagtaccgcggatcggtgtccctggtggtgaatgtggccagcgagtgcggcttcaca
gaccagcactaccgagccctgcagcagctgcagcgagacctgggcccccaccactttaac
gtgctcgccttcccctgcaaccagtttggccaacaggagcctgacagcaacaaggagatt
gagagctttgcccgccgcacctacagtgtctcattccccatgtttagcaagattgcagtc
accggtactggtgcccatcctgccttcaagtacctggcccagacttctgggaaggagccc
acctggaacttctggaagtacctagtagccccagatggaaaggtggtaggggcttgggac
ccaactgtgtcagtggaggaggtcagaccccagatcacagcgctcgtgaggaagctcatc
ctactgaagcgagaagacttataa

KEGG   Homo sapiens (human): 493869
Entry
493869            CDS       T01001                                 

Gene name
GPX8, EPLA847, GPx-8, GSHPx-8, UNQ847
Definition
(RefSeq) glutathione peroxidase 8 (putative)
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00480  Glutathione metabolism
hsa00590  Arachidonic acid metabolism
hsa01100  Metabolic pathways
hsa04918  Thyroid hormone synthesis
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05022  Pathways of neurodegeneration - multiple diseases
Network
nt06026  Glutathione biosynthesis
  Element
N00899  Glutathione biosynthesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    493869 (GPX8)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    493869 (GPX8)
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    493869 (GPX8)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    493869 (GPX8)
   05016 Huntington disease
    493869 (GPX8)
   05022 Pathways of neurodegeneration - multiple diseases
    493869 (GPX8)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     493869 (GPX8)
SSDB
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Other DBs
NCBI-GeneID: 493869
NCBI-ProteinID: NP_001008398
OMIM: 617172
HGNC: 33100
Ensembl: ENSG00000164294
Vega: OTTHUMG00000162601
Pharos: Q8TED1(Tbio)
UniProt: Q8TED1
LinkDB
Structure
PDB: 
3KIJ 3CYN

Position
5q11.2
AA seq 209 aa
MEPLAAYPLKCSGPRAKVFAVLLSIVLCTVTLFLLQLKFLKPKINSFYAFEVKDAKGRTV
SLEKYKGKVSLVVNVASDCQLTDRNYLGLKELHKEFGPSHFSVLAFPCNQFGESEPRPSK
EVESFARKNYGVTFPIFHKIKILGSEGEPAFRFLVDSSKKEPRWNFWKYLVNPEGQVVKF
WKPEEPIEVIRPDIAALVRQVIIKKKEDL
NT seq 630 nt   +upstreamnt  +downstreamnt
atggagcctcttgcagcttacccgctaaaatgttccgggcccagagcaaaggtatttgca
gttttgctgtctatagttctatgcacagtaacgctatttcttctacaactaaaattcctc
aaacctaaaatcaacagcttttatgcctttgaagtgaaggatgcaaaaggaagaactgtt
tctctggaaaagtataaaggcaaagtttcactagttgtaaacgtggccagtgactgccaa
ctcacagacagaaattacttagggctgaaggaactgcacaaagagtttggaccatcccac
ttcagcgtgttggcttttccctgcaatcagtttggagaatcggagccccgcccaagcaag
gaagtagaatcttttgcaagaaaaaactacggagtaactttccccatcttccacaagatt
aagattctaggatctgaaggagaacctgcatttagatttcttgttgattcttcaaagaag
gaaccaaggtggaatttttggaagtatcttgtcaaccctgagggtcaagttgtgaagttc
tggaagccagaggagcccattgaagtcatcaggcctgacatagcagctctggttagacaa
gtgatcataaaaaagaaagaggatctatga

DBGET integrated database retrieval system