KEGG   Homo sapiens (human): 25776Help
Entry
25776             CDS       T01001                                 

Gene name
CBY1, C22orf2, CBY, Chibby1, HS508I15A, PGEA1, PIGEA-14, PIGEA14, arb1
Definition
(RefSeq) chibby family member 1, beta catenin antagonist
  KO
K23402  protein chibby 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    25776 (CBY1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    25776 (CBY1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other cilium assembly proteins
    25776 (CBY1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Chibby TSC22
Motif
Other DBs
NCBI-GeneID: 25776
NCBI-ProteinID: NP_056188
OMIM: 607757
HGNC: 1307
Ensembl: ENSG00000100211
Vega: OTTHUMG00000150990
Pharos: Q9Y3M2(Tbio)
UniProt: Q9Y3M2 A0A024R1L9
LinkDB All DBs
Position
22q13.1
AA seq 126 aa AA seqDB search
MPFFGNTFSPKKTPPRKSASLSNLHSLDRSTREVELGLEYGSPTMNLAGQSLKFENGQWI
AETGVSGGVDRREVQRLRRRNQQLEEENNLLRLKVDILLDMLSESTAESHLMEKELDELR
ISRKRK
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgcctttctttgggaatacgttcagtccgaagaagacacctcctcggaagtcggcatct
ctctccaacctgcattctttggatcgatcaacccgggaggtggagctgggcttggaatac
ggatccccgactatgaacctggcagggcaaagcctgaagtttgaaaatggccagtggata
gcagagacaggggttagtggcggtgtggaccggagggaggttcagcgccttcgcaggcgg
aaccagcagttggaggaagagaacaatctcttgcggctgaaagtggacatcttattagac
atgctttcagagtccactgctgaatcccacttaatggagaaggaactggatgaactgagg
atcagccggaagagaaaatga

DBGET integrated database retrieval system