KEGG   Homo sapiens (human): 25805Help
Entry
25805             CDS       T01001                                 

Gene name
BAMBI, NMA
Definition
(RefSeq) BMP and activin membrane bound inhibitor
  KO
K10162  BMP and activin membrane-bound inhibitor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04310  Wnt signaling pathway
hsa04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    25805 (BAMBI)
   04350 TGF-beta signaling pathway
    25805 (BAMBI)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BAMBI LapA_dom EphA2_TM
Motif
Other DBs
NCBI-GeneID: 25805
NCBI-ProteinID: NP_036474
OMIM: 604444
HGNC: 30251
Ensembl: ENSG00000095739
Vega: OTTHUMG00000017874
Pharos: Q13145(Tbio)
UniProt: Q13145
LinkDB All DBs
Position
10p12.1
AA seq 260 aa AA seqDB search
MDRHSSYIFIWLQLELCAMAVLLTKGEIRCYCDAAHCVATGYMCKSELSACFSRLLDPQN
SNSPLTHGCLDSLASTTDICQAKQARNHSGTTIPTLECCHEDMCNYRGLHDVLSPPRGEA
SGQGNRYQHDGSRNLITKVQELTSSKELWFRAAVIAVPIAGGLILVLLIMLALRMLRSEN
KRLQDQRQQMLSRLHYSFHGHHSKKGQVAKLDLECMVPVSGHENCCLTCDKMRQADLSND
KILSLVHWGMYSGHGKLEFV
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggatcgccactccagctacatcttcatctggctgcagctggagctctgcgccatggcc
gtgctgctcaccaaaggtgaaattcgatgctactgtgatgctgcccactgtgtagccact
ggttatatgtgtaaatctgagctcagcgcctgcttctctagacttcttgatcctcagaac
tcaaattccccactcacccatggctgcctggactctcttgcaagcacgacagacatctgc
caagccaaacaggcccgaaaccactctggcaccaccatacccacattggaatgctgtcat
gaagacatgtgcaattacagagggctgcacgatgttctctctcctcccaggggtgaggcc
tcaggacaaggaaacaggtatcagcatgatggtagcagaaaccttatcaccaaggtgcag
gagctgacttcttccaaagagttgtggttccgggcagcggtcattgccgtgcccattgct
ggagggctgattttagtgttgcttattatgttggccctgaggatgcttcgaagtgaaaat
aagaggctgcaggatcagcggcaacagatgctctcccgtttgcactacagctttcacgga
caccattccaaaaaggggcaggttgcaaagttagacttggaatgcatggtgccggtcagt
gggcacgagaactgctgtctgacctgtgataaaatgagacaagcagacctcagcaacgat
aagatcctctcgcttgttcactggggcatgtacagtgggcacgggaagctggaattcgta
tga

DBGET integrated database retrieval system