KEGG   Homo sapiens (human): 25824
Entry
25824             CDS       T01001                                 

Gene name
PRDX5, ACR1, AOEB166, B166, HEL-S-55, PLP, PMP20, PRDX6, PRXV, SBBI10, prx-V
Definition
(RefSeq) peroxiredoxin 5
  KO
K11187  peroxiredoxin 5 [EC:1.11.1.24]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    25824 (PRDX5)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.24  thioredoxin-dependent peroxiredoxin
     25824 (PRDX5)
SSDB
Motif
Pfam: Redoxin AhpC-TSA NAD_binding_10
Other DBs
NCBI-GeneID: 25824
NCBI-ProteinID: NP_036226
OMIM: 606583
HGNC: 9355
Ensembl: ENSG00000126432
Vega: OTTHUMG00000168805
Pharos: P30044(Tbio)
UniProt: P30044
LinkDB
Structure
PDB: 

Position
11q13.1
AA seq 214 aa
MGLAGVCALRRSAGYILVGGAGGQSAAAAARRYSEGEWASGGVRSFSRAAAAMAPIKVGD
AIPAVEVFEGEPGNKVNLAELFKGKKGVLFGVPGAFTPGCSKTHLPGFVEQAEALKAKGV
QVVACLSVNDAFVTGEWGRAHKAEGKVRLLADPTGAFGKETDLLLDDSLVSIFGNRRLKR
FSMVVQDGIVKALNVEPDGTGLTCSLAPNIISQL
NT seq 645 nt   +upstreamnt  +downstreamnt
atgggactagctggcgtgtgcgccctgagacgctcagcgggctatatactcgtcggtggg
gccggcggtcagtctgcggcagcggcagcaagacggtacagtgaaggagagtgggcgtct
ggcggggtccgcagtttcagcagagccgctgcagccatggccccaatcaaggtgggagat
gccatcccagcagtggaggtgtttgaaggggagccagggaacaaggtgaacctggcagag
ctgttcaagggcaagaagggtgtgctgtttggagttcctggggccttcacccctggatgt
tccaagacacacctgccagggtttgtggagcaggctgaggctctgaaggccaagggagtc
caggtggtggcctgtctgagtgttaatgatgcctttgtgactggcgagtggggccgagcc
cacaaggcggaaggcaaggttcggctcctggctgatcccactggggcctttgggaaggag
acagacttattactagatgattcgctggtgtccatctttgggaatcgacgtctcaagagg
ttctccatggtggtacaggatggcatagtgaaggccctgaatgtggaaccagatggcaca
ggcctcacctgcagcctggcacccaatatcatctcacagctctga

DBGET integrated database retrieval system