KEGG   Homo sapiens (human): 25898
Entry
25898             CDS       T01001                                 

Gene name
RCHY1, ARNIP, CHIMP, PIRH2, PRO1996, RNF199, ZCHY, ZNF363
Definition
(RefSeq) ring finger and CHY zinc finger domain containing 1
  KO
K10144  RING finger and CHY zinc finger domain-containing protein 1 [EC:2.3.2.27]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04115  p53 signaling pathway
hsa04120  Ubiquitin mediated proteolysis
hsa05162  Measles
Network
nt06169  Measles virus (MV)
  Element
N00697  HV P to p53-mediated transcription
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    25898 (RCHY1)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    25898 (RCHY1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    25898 (RCHY1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    25898 (RCHY1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     25898 (RCHY1)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    25898 (RCHY1)
SSDB
Motif
Pfam: zinc_ribbon_6 zf-CHY zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_UBOX zf-RING_5 zf-C3HC4_3 Prok-RING_4 zf-RING_11
Other DBs
NCBI-GeneID: 25898
NCBI-ProteinID: NP_056251
OMIM: 607680
HGNC: 17479
Ensembl: ENSG00000163743
Vega: OTTHUMG00000130105
Pharos: Q96PM5(Tbio)
UniProt: Q96PM5
LinkDB
Structure
PDB: 
2K2C 2K2D 2JRJ

Position
4q21.1
AA seq 261 aa
MAATAREDGASGQERGQRGCEHYDRGCLLKAPCCDKLYTCRLCHDNNEDHQLDRFKVKEV
QCINCEKIQHAQQTCEECSTLFGEYYCDICHLFDKDKKQYHCENCGICRIGPKEDFFHCL
KCNLCLAMNLQGRHKCIENVSRQNCPICLEDIHTSRVVAHVLPCGHLLHRTCYEEMLKEG
YRCPLCMHSALDMTRYWRQLDDEVAQTPMPSEYQNMTVDILCNDCNGRSTVQFHILGMKC
KICESYNTAQAGGRRISLDQQ
NT seq 786 nt   +upstreamnt  +downstreamnt
atggcggcgacggcccgggaagatggcgccagcggtcaagagcgaggtcagcggggctgc
gagcactatgacagaggatgtctcctaaaggcaccttgctgtgacaagctttatacttgc
cgcttgtgtcatgataacaatgaagatcatcaactagatcgctttaaagtgaaggaagtg
cagtgcataaactgtgaaaaaattcaacatgcccaacagacttgtgaagaatgtagcaca
ttgtttggagaatattattgcgatatatgccatttgtttgacaaagataagaagcagtat
cactgtgaaaactgtggaatttgtaggattggtccaaaggaagattttttccattgtttg
aaatgtaacttatgcctagctatgaatcttcaaggaagacacaagtgtattgaaaatgtg
tcccgacagaattgtccaatatgtttggaggacattcacacatcccgtgttgttgctcat
gtcttgccatgtggacatcttttacatagaacgtgttatgaagaaatgttgaaagaaggc
tacagatgtccattatgtatgcactctgctttagatatgaccaggtattggagacagctg
gatgatgaagtagcacagactcctatgccatcagaatatcagaacatgactgtggatatt
ctctgcaatgactgtaatggacgatccactgttcagtttcatatattaggcatgaaatgt
aagatttgtgaatcctataatactgctcaagctggaggacgtagaatttcactggatcag
caatga

DBGET integrated database retrieval system