KEGG   Homo sapiens (human): 259197Help
Entry
259197            CDS       T01001                                 

Gene name
NCR3, 1C7, CD337, LY117, MALS, NKp30
Definition
(RefSeq) natural cytotoxicity triggering receptor 3
  KO
K06743  natural cytotoxicity triggering receptor 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04650  Natural killer cell mediated cytotoxicity
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    259197 (NCR3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    259197 (NCR3)
CD molecules [BR:hsa04090]
 Proteins
  259197 (NCR3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: V-set Ig_3 ig I-set Ig_2
Motif
Other DBs
NCBI-GeneID: 259197
NCBI-ProteinID: NP_667341
OMIM: 611550
HGNC: 19077
Ensembl: ENSG00000204475
Vega: OTTHUMG00000031123
Pharos: O14931(Tbio)
UniProt: O14931
LinkDB All DBs
Structure
PDB: 

Position
6p21.33
AA seq 201 aa AA seqDB search
MAWMLLLILIMVHPGSCALWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEV
VPGKEVRNGTPEFRGRLAPLASSRFLHDHQAELHIRDVRGHDASIYVCRVEVLGLGVGTG
NGTRLVVEKEHPQLGAGTVLLLRAGFYAVSFLSVAVGSTVYYQGKCLTWKGPRRQLPAVV
PAPLPPPCGSSAHLLPPVPGG
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggcctggatgctgttgctcatcttgatcatggtccatccaggatcctgtgctctctgg
gtgtcccagccccctgagattcgtaccctggaaggatcctctgccttcctgccctgctcc
ttcaatgccagccaagggagactggccattggctccgtcacgtggttccgagatgaggtg
gttccagggaaggaggtgaggaatggaaccccagagttcaggggccgcctggccccactt
gcttcttcccgtttcctccatgaccaccaggctgagctgcacatccgggacgtgcgaggc
catgacgccagcatctacgtgtgcagagtggaggtgctgggccttggtgtcgggacaggg
aatgggactcggctggtggtggagaaagaacatcctcagctaggggctggtacagtcctc
ctccttcgggctggattctatgctgtcagctttctctctgtggccgtgggcagcaccgtc
tattaccagggcaaatgtctgacctggaaaggtccaagaaggcagctgccggctgtggtc
ccagcgcccctcccaccaccatgtgggagctcagcacatctgcttcccccagtcccagga
ggctga

DBGET integrated database retrieval system