KEGG   Homo sapiens (human): 259285
Entry
259285            CDS       T01001                                 

Gene name
TAS2R39, T2R39, T2R57
Definition
(RefSeq) taste 2 receptor member 39
  KO
K08474  taste receptor type 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04742 Taste transduction
    259285 (TAS2R39)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    259285 (TAS2R39)
G protein-coupled receptors [BR:hsa04030]
 Others
  Chemoreception
   Taste
    259285 (TAS2R39)
SSDB
Motif
Pfam: TAS2R
Other DBs
NCBI-GeneID: 259285
NCBI-ProteinID: NP_795362
HGNC: 18886
Ensembl: ENSG00000236398
Vega: OTTHUMG00000152636
Pharos: P59534(Tbio)
UniProt: P59534
LinkDB
Position
7q34
AA seq 338 aa
MLGRCFPPDTKEKQQLRMTKLCDPAESELSPFLITLILAVLLAEYLIGIIANGFIMAIHA
AEWVQNKAVSTSGRILVFLSVSRIALQSLMMLEITISSTSLSFYSEDAVYYAFKISFIFL
NFCSLWFAAWLSFFYFVKIANFSYPLFLKLRWRITGLIPWLLWLSVFISFSHSMFCINIC
TVYCNNSFPIHSSNSTKKTYLSEINVVGLAFFFNLGIVTPLIMFILTATLLILSLKRHTL
HMGSNATGSNDPSMEAHMGAIKAISYFLILYIFNAVALFIYLSNMFDINSLWNNLCQIIM
AAYPASHSILLIQDNPGLRRAWKRLQLRLHLYPKEWTL
NT seq 1017 nt   +upstreamnt  +downstreamnt
atgctagggagatgttttcctccagacaccaaagagaagcaacagctcagaatgactaaa
ctctgcgatcctgcagaaagtgaattgtcgccatttctcatcaccttaattttagcagtt
ttacttgctgaatacctcattggtatcattgcaaatggtttcatcatggctatacatgca
gctgaatgggttcaaaataaggcagtttccacaagtggcaggatcctggttttcctgagt
gtatccagaatagctctccaaagcctcatgatgttagaaattaccatcagctcaacctcc
ctaagtttttattctgaagacgctgtatattatgcattcaaaataagttttatattctta
aatttttgtagcctgtggtttgctgcctggctcagtttcttctactttgtgaagattgcc
aatttctcctacccccttttcctcaaactgaggtggagaattactggattgataccctgg
cttctgtggctgtccgtgtttatttccttcagtcacagcatgttctgcatcaacatctgc
actgtgtattgtaacaattctttccctatccactcctccaactccactaagaaaacatac
ttgtctgagatcaatgtggtcggtctggcttttttctttaacctggggattgtgactcct
ctgatcatgttcatcctgacagccaccctgctgatcctctctctcaagagacacacccta
cacatgggaagcaatgccacagggtccaacgaccccagcatggaggctcacatgggggcc
atcaaagctatcagctactttctcattctctacattttcaatgcagttgctctgtttatc
tacctgtccaacatgtttgacatcaacagtctgtggaataatttgtgccagatcatcatg
gctgcctaccctgccagccactcaattctactgattcaagataaccctgggctgagaaga
gcctggaagcggcttcagcttcgacttcatctttacccaaaagagtggactctgtga

KEGG   Homo sapiens (human): 259286
Entry
259286            CDS       T01001                                 

Gene name
TAS2R40, GPR60, T2R40, T2R58
Definition
(RefSeq) taste 2 receptor member 40
  KO
K08474  taste receptor type 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04742 Taste transduction
    259286 (TAS2R40)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    259286 (TAS2R40)
G protein-coupled receptors [BR:hsa04030]
 Others
  Chemoreception
   Taste
    259286 (TAS2R40)
SSDB
Motif
Pfam: TAS2R
Other DBs
NCBI-GeneID: 259286
NCBI-ProteinID: NP_795363
OMIM: 613964
HGNC: 18885
Ensembl: ENSG00000221937
Vega: OTTHUMG00000152638
Pharos: P59535(Tbio)
UniProt: P59535
LinkDB
Position
7q34
AA seq 323 aa
MATVNTDATDKDISKFKVTFTLVVSGIECITGILGSGFITAIYGAEWARGKTLPTGDRIM
LMLSFSRLLLQIWMMLENIFSLLFRIVYNQNSVYILFKVITVFLNHSNLWFAAWLKVFYC
LRIANFNHPLFFLMKRKIIVLMPWLLRLSVLVSLSFSFPLSRDVFNVYVNSSIPIPSSNS
TEKKYFSETNMVNLVFFYNMGIFVPLIMFILAATLLILSLKRHTLHMGSNATGSRDPSMK
AHIGAIKATSYFLILYIFNAIALFLSTSNIFDTYSSWNILCKIIMAAYPAGHSVQLILGN
PGLRRAWKRFQHQVPLYLKGQTL
NT seq 972 nt   +upstreamnt  +downstreamnt
atggcaacggtgaacacagatgccacagataaagacatatccaagttcaaggtcaccttc
actttggtggtctccggaatagagtgcatcactggcatccttgggagtggcttcatcacg
gccatctatggggctgagtgggccaggggcaaaacactccccactggtgaccgcattatg
ttgatgctgagcttttccaggctcttgctacagatttggatgatgctggagaacattttc
agtctgctattccgaattgtttataaccaaaactcagtgtatatcctcttcaaagtcatc
actgtctttctgaaccattccaatctctggtttgctgcctggctcaaagtcttctattgt
cttagaattgcaaacttcaatcatcctttgttcttcctgatgaagaggaaaatcatagtg
ctgatgccttggcttctcaggctgtcagtgttggtttccttaagcttcagctttcctctc
tcgagagatgtcttcaatgtgtatgtgaatagctccattcctatcccctcctccaactcc
acggagaagaagtacttctctgagaccaatatggtcaacctggtatttttctataacatg
gggatcttcgttcctctgatcatgttcatcctggcagccaccctgctgatcctctctctc
aagagacacaccctacacatgggaagcaatgccacagggtccagggaccccagcatgaag
gctcacataggggccatcaaagccaccagctactttctcatcctctacattttcaatgca
attgctctatttctttccacgtccaacatctttgacacttacagttcctggaatattttg
tgcaagatcatcatggctgcctaccctgccggccactcagtacaactgatcttgggcaac
cctgggctgagaagagcctggaagcggtttcagcaccaagttcctctttacctaaaaggg
cagactctgtga

KEGG   Homo sapiens (human): 259287
Entry
259287            CDS       T01001                                 

Gene name
TAS2R41, T2R41, T2R59
Definition
(RefSeq) taste 2 receptor member 41
  KO
K08474  taste receptor type 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04742 Taste transduction
    259287 (TAS2R41)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    259287 (TAS2R41)
G protein-coupled receptors [BR:hsa04030]
 Others
  Chemoreception
   Taste
    259287 (TAS2R41)
SSDB
Motif
Pfam: TAS2R CcmH
Other DBs
NCBI-GeneID: 259287
NCBI-ProteinID: NP_795364
OMIM: 613965
HGNC: 18883
Ensembl: ENSG00000221855
Vega: OTTHUMG00000155892
Pharos: P59536(Tbio)
UniProt: P59536
LinkDB
Position
7q35
AA seq 307 aa
MQAALTAFFVLLFSLLSLLGIAANGFIVLVLGREWLRYGRLLPLDMILISLGASRFCLQL
VGTVHNFYYSAQKVEYSGGLGRQFFHLHWHFLNSATFWFCSWLSVLFCVKIANITHSTFL
WLKWRFPGWVPWLLLGSVLISFIITLLFFWVNYPVYQEFLIRKFSGNMTYKWNTRIETYY
FPSLKLVIWSIPFSVFLVSIMLLINSLRRHTQRMQHNGHSLQDPSTQAHTRALKSLISFL
ILYALSFLSLIIDAAKFISMQNDFYWPWQIAVYLCISVHPFILIFSNLKLRSVFSQLLLL
ARGFWVA
NT seq 924 nt   +upstreamnt  +downstreamnt
atgcaagcagcactgacggccttcttcgtgttgctctttagcctgctgagtcttctgggg
attgcagcgaatggcttcattgtgctggtgctgggcagggagtggctgcgatatggcagg
ttgctgcccttggatatgatcctcattagcttgggtgcctcccgcttctgcctgcagttg
gttgggacggtgcacaacttctactactctgcccagaaggtcgagtactctgggggtctc
ggccgacagttcttccatctacactggcacttcctgaactcagccaccttctggttttgc
agctggctcagtgtcctgttctgtgtgaagattgctaacatcacacactccaccttcctg
tggctgaagtggaggttcccagggtgggtgccctggctcctgttgggctctgtcctgatc
tccttcatcataaccctgctgtttttttgggtgaactaccctgtatatcaagaattttta
attagaaaattttctgggaacatgacctacaagtggaatacaaggatagaaacatactat
ttcccatccctgaaactggtcatctggtcaattcctttttctgtttttctggtctcaatt
atgctgttaattaattctctgaggaggcatactcagagaatgcagcacaacgggcacagc
ctgcaggaccccagcacccaggctcacaccagagctctgaagtccctcatctccttcctc
attctttatgctctgtcctttctgtccctgatcattgatgccgcaaaatttatctccatg
cagaacgacttttactggccatggcaaattgcagtctacctgtgcatatctgtccatccc
ttcatcctcatcttcagcaacctcaagcttcgaagcgtgttctcgcagctcctgttgttg
gcaaggggcttctgggtggcctag

KEGG   Homo sapiens (human): 259289
Entry
259289            CDS       T01001                                 

Gene name
TAS2R43, T2R43, T2R52
Definition
(RefSeq) taste 2 receptor member 43
  KO
K08474  taste receptor type 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04742 Taste transduction
    259289 (TAS2R43)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    259289 (TAS2R43)
G protein-coupled receptors [BR:hsa04030]
 Others
  Chemoreception
   Taste
    259289 (TAS2R43)
SSDB
Motif
Pfam: TAS2R
Other DBs
NCBI-GeneID: 259289
NCBI-ProteinID: NP_795365
OMIM: 612668
HGNC: 18875
Ensembl: ENSG00000255374
Vega: OTTHUMG00000165352
Pharos: P59537(Tbio)
UniProt: P59537
LinkDB
Position
12p13.2
AA seq 309 aa
MITFLPIIFSSLVVVTFVIGNFANGFIALVNSIEWFKRQKISFADQILTALAVSRVGLLW
VLLLNWYSTVLNPAFNSVEVRTTAYNIWAVINHFSNWLATTLSIFYLLKIANFSNFIFLH
LKRRVKSVILVMLLGPLLFLACHLFVINMNEIVRTKEFEGNMTWKIKLKSAMYFSNMTVT
MVANLVPFTLTLLSFMLLICSLCKHLKKMQLHGKGSQDPSTKVHIKALQTVISFLLLCAI
YFLSIMISVWSFGSLENKPVFMFCKAIRFSYPSIHPFILIWGNKKLKQTFLSVFWQMRYW
VKGEKTSSP
NT seq 930 nt   +upstreamnt  +downstreamnt
atgataacttttctacccatcattttttccagtctggtagtggttacatttgttattgga
aattttgctaatggcttcatagcactggtaaattccattgagtggttcaagagacaaaag
atctcctttgctgaccaaattctcactgctctggcggtctccagagttggtttgctctgg
gtattattattaaactggtattcaactgtgttgaatccagcttttaatagtgtagaagta
agaactactgcttataatatctgggcagtgatcaaccatttcagcaactggcttgctact
accctcagcatattttatttgctcaagattgccaatttctccaactttatttttcttcac
ttaaagaggagagttaagagtgtcattctggtgatgttgttggggcctttgctatttttg
gcttgtcatctttttgtgataaacatgaatgagattgtgcggacaaaagaatttgaagga
aacatgacttggaagatcaaattgaagagtgcaatgtacttttcaaatatgactgtaacc
atggtagcaaacttagtacccttcactctgaccctactatcttttatgctgttaatctgt
tctttgtgtaaacatctcaagaagatgcagctccatggtaaaggatctcaagatcccagc
accaaggtccacataaaagctttgcaaactgtgatctccttcctcttgttatgtgccatt
tactttctgtccataatgatatcagtttggagttttggaagtctggaaaacaaacctgtc
ttcatgttctgcaaagctattagattcagctatccttcaatccacccattcatcctgatt
tggggaaacaagaagctaaagcagacttttctttcagttttttggcaaatgaggtactgg
gtgaaaggagagaagacttcatctccatag

KEGG   Homo sapiens (human): 259290
Entry
259290            CDS       T01001                                 

Gene name
TAS2R31, T2R31, T2R44, T2R53, TAS2R44
Definition
(RefSeq) taste 2 receptor member 31
  KO
K08474  taste receptor type 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04742 Taste transduction
    259290 (TAS2R31)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    259290 (TAS2R31)
G protein-coupled receptors [BR:hsa04030]
 Others
  Chemoreception
   Taste
    259290 (TAS2R31)
SSDB
Motif
Pfam: TAS2R DUF443
Other DBs
NCBI-GeneID: 259290
NCBI-ProteinID: NP_795366
OMIM: 612669
HGNC: 19113
Ensembl: ENSG00000256436
Vega: OTTHUMG00000168558
Pharos: P59538(Tbio)
UniProt: P59538
LinkDB
Position
12p13.2
AA seq 309 aa
MTTFIPIIFSSVVVVLFVIGNFANGFIALVNSIERVKRQKISFADQILTALAVSRVGLLW
VLLLNWYSTVFNPAFYSVEVRTTAYNVWAVTGHFSNWLATSLSIFYLLKIANFSNLIFLH
LKRRVKSVILVMLLGPLLFLACQLFVINMKEIVRTKEYEGNLTWKIKLRSAVYLSDATVT
TLGNLVPFTLTLLCFLLLICSLCKHLKKMQLHGKGSQDPSTKVHIKALQTVIFFLLLCAV
YFLSIMISVWSFGSLENKPVFMFCKAIRFSYPSIHPFILIWGNKKLKQTFLSVLRQVRYW
VKGEKPSSP
NT seq 930 nt   +upstreamnt  +downstreamnt
atgacaacttttatacccatcattttttccagtgtggtagtggttctatttgttattgga
aattttgctaatggcttcatagcattggtaaattccattgagcgggtcaagagacaaaag
atctcttttgctgaccagattctcactgctctggcggtctccagagttggtttgctctgg
gtattattattaaattggtattcaactgtgtttaatccagctttttatagtgtagaagta
agaactactgcttataatgtctgggcagtaaccggccatttcagcaactggcttgctact
agcctcagcatattttatttgctcaagattgccaatttctccaaccttatttttcttcac
ttaaagaggagagttaagagtgtcattctggtgatgctgttggggcctttactatttttg
gcttgtcaactttttgtgataaacatgaaagagattgtacggacaaaagaatatgaagga
aacttgacttggaagatcaaattgaggagtgcagtgtacctttcagatgcgactgtaacc
acgctaggaaacttagtgcccttcactctgaccctgctatgttttttgctgttaatctgt
tctctgtgtaaacatctcaagaagatgcagctccatggtaaaggatctcaagatcccagc
accaaggtccacataaaagctttgcaaactgtgatctttttcctcttgttatgtgccgtt
tactttctgtccataatgatatcagtttggagttttgggagtctggaaaacaaacctgtc
ttcatgttctgcaaagctattagattcagctatccttcaatccacccattcatcctgatt
tggggaaacaagaagctaaagcagacttttctttcagttttgcggcaagtgaggtactgg
gtgaaaggagagaagccttcatctccatag

KEGG   Homo sapiens (human): 259291
Entry
259291            CDS       T01001                                 

Gene name
TAS2R45, GPR59, T2R45, ZG24P
Definition
(RefSeq) taste 2 receptor member 45
  KO
K08474  taste receptor type 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04742 Taste transduction
    259291 (TAS2R45)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    259291 (TAS2R45)
G protein-coupled receptors [BR:hsa04030]
 Others
  Chemoreception
   Taste
    259291 (TAS2R45)
SSDB
Motif
Pfam: TAS2R
Other DBs
NCBI-GeneID: 259291
NCBI-ProteinID: NP_795367
OMIM: 613967
HGNC: 18876
UniProt: A0A0J9YXD8
LinkDB
Position
12p13.2
AA seq 299 aa
MITFLPIIFSILVVVTFVIGNFANGFIALVNSTEWVKRQKISFADQIVTALAVSRVGLLW
VLLLNWYSTVLNPAFYSVELRTTAYNIWAVTGHFSNWPATSLSIFYLLKIANFSNLIFLR
LKRRVKSVILVVLLGPLLFLACHLFVVNMNQIVWTKEYEGNMTWKIKLRRAMYLSDTTVT
MLANLVPFTVTLISFLLLVCSLCKHLKKMQLHGKGSQDPSTKVHIKVLQTVISFFLLRAI
YFVSVIISVWSFKNLENKPVFMFCQAIGFSCSSAHPFILIWGNKKLKQTYLSVLWQMRY
NT seq 900 nt   +upstreamnt  +downstreamnt
atgataacttttctgcccatcatattttccattctagtagtggttacatttgttattgga
aattttgctaatggcttcatagcgttggtaaattccaccgagtgggtgaagagacaaaag
atctcctttgctgaccaaattgtcactgctctggcggtctccagagttggtttgctctgg
gtgttattattaaattggtattcaactgtgttgaatccagctttttatagtgtagaatta
agaactactgcttataatatctgggcagtaaccggccatttcagcaactggcctgctact
agcctcagcatattttatttgctcaagattgccaatttctccaaccttatttttcttcgc
ttaaagaggagagttaagagtgtcattctggtggtgctgttggggcctttgctatttttg
gcttgtcatctttttgtggtaaacatgaatcagattgtatggacaaaagaatatgaagga
aacatgacttggaagatcaaattgaggcgtgcaatgtacctttcagatacgactgtaacc
atgctagcaaacttagtaccctttactgtaaccctgatatcttttctgctgttagtctgt
tctctgtgtaaacatctcaagaagatgcagctccatggcaaaggatctcaagatcccagt
accaaggtccacataaaagttttgcaaactgtgatctccttcttcttgttacgtgccatt
tactttgtgtctgtaataatatcagtttggagttttaagaatctggaaaacaaacctgtc
ttcatgttctgccaagctattggattcagctgttcttcagcccacccgttcatcctgatt
tggggaaacaagaagctaaagcagacttatctttcagttttgtggcaaatgaggtactga

KEGG   Homo sapiens (human): 259292
Entry
259292            CDS       T01001                                 

Gene name
TAS2R46, T2R46, T2R54
Definition
(RefSeq) taste 2 receptor member 46
  KO
K08474  taste receptor type 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04742 Taste transduction
    259292 (TAS2R46)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    259292 (TAS2R46)
G protein-coupled receptors [BR:hsa04030]
 Others
  Chemoreception
   Taste
    259292 (TAS2R46)
SSDB
Motif
Pfam: TAS2R PAG
Other DBs
NCBI-GeneID: 259292
NCBI-ProteinID: NP_795368
OMIM: 612774
HGNC: 18877
Ensembl: ENSG00000226761
Vega: OTTHUMG00000165351
Pharos: P59540(Tbio)
UniProt: P59540
LinkDB
Position
12p13.2
AA seq 309 aa
MITFLPIIFSILIVVTFVIGNFANGFIALVNSIEWFKRQKISFADQILTALAVSRVGLLW
VLVLNWYATELNPAFNSIEVRITAYNVWAVINHFSNWLATSLSIFYLLKIANFSNLIFLH
LKRRVKSVVLVILLGPLLFLVCHLFVINMNQIIWTKEYEGNMTWKIKLRSAMYLSNTTVT
ILANLVPFTLTLISFLLLICSLCKHLKKMQLHGKGSQDPSMKVHIKALQTVTSFLLLCAI
YFLSIIMSVWSFESLENKPVFMFCEAIAFSYPSTHPFILIWGNKKLKQTFLSVLWHVRYW
VKGEKPSSS
NT seq 930 nt   +upstreamnt  +downstreamnt
atgataacttttctgcccatcattttttccattctaatagtggttacatttgtgattgga
aattttgctaatggcttcatagcattggtaaattccattgagtggttcaagagacaaaag
atctcttttgctgaccaaattctcactgctctggcagtctccagagttggtttactctgg
gtattagtattaaattggtatgcaactgagttgaatccagcttttaacagtatagaagta
agaattactgcttacaatgtctgggcagtaatcaaccatttcagcaactggcttgctact
agcctcagcatattttatttgctcaagattgccaatttctccaaccttatttttcttcac
ttaaagaggagagttaagagtgttgttctggtgatactattggggcctttgctatttttg
gtttgtcatctttttgtgataaacatgaatcagattatatggacaaaagaatatgaagga
aacatgacttggaagatcaaactgaggagtgcaatgtacctttcaaatacaacggtaacc
atcctagcaaacttagttcccttcactctgaccctgatatcttttctgctgttaatctgt
tctctgtgtaaacatctcaaaaagatgcagctccatggcaaaggatctcaagatcccagc
atgaaggtccacataaaagctttgcaaactgtgacctccttcctcttgttatgtgccatt
tactttctgtccataatcatgtcagtttggagttttgagagtctggaaaacaaacctgtc
ttcatgttctgcgaagctattgcattcagctatccttcaacccacccattcatcctgatt
tggggaaacaagaagctaaagcagacttttctttcagttttgtggcatgtgaggtactgg
gtgaaaggagagaagccttcatcttcatag

KEGG   Homo sapiens (human): 259293
Entry
259293            CDS       T01001                                 

Gene name
TAS2R30, T2R30, T2R47, TAS2R47
Definition
(RefSeq) taste 2 receptor member 30
  KO
K08474  taste receptor type 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04742 Taste transduction
    259293 (TAS2R30)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    259293 (TAS2R30)
G protein-coupled receptors [BR:hsa04030]
 Others
  Chemoreception
   Taste
    259293 (TAS2R30)
SSDB
Motif
Pfam: TAS2R
Other DBs
NCBI-GeneID: 259293
NCBI-ProteinID: NP_001091112
OMIM: 613963
HGNC: 19112
Ensembl: ENSG00000256188
Vega: OTTHUMG00000168562
Pharos: P59541(Tbio)
UniProt: P59541
LinkDB
Position
12p13.2
AA seq 319 aa
MITFLPIIFSILIVVIFVIGNFANGFIALVNSIEWVKRQKISFVDQILTALAVSRVGLLW
VLLLHWYATQLNPAFYSVEVRITAYNVWAVTNHFSSWLATSLSMFYLLRIANFSNLIFLR
IKRRVKSVVLVILLGPLLFLVCHLFVINMDETVWTKEYEGNVTWKIKLRSAMYHSNMTLT
MLANFVPLTLTLISFLLLICSLCKHLKKMQLHGKGSQDPSTKVHIKALQTVTSFLLLCAI
YFLSMIISVCNFGRLEKQPVFMFCQAIIFSYPSTHPFILILGNKKLKQIFLSVLRHVRYW
VKDRSLRLHRFTRGALCVF
NT seq 960 nt   +upstreamnt  +downstreamnt
atgataacttttctgcccatcattttttccattctaatagtggttatatttgttattgga
aattttgctaatggcttcatagcattggtaaattccattgagtgggtcaagagacaaaag
atctcctttgttgaccaaattctcactgctctggcggtctccagagttggtttgctctgg
gtgttattactacattggtatgcaactcagttgaatccagctttttatagtgtagaagta
agaattactgcttataatgtctgggcagtaaccaaccatttcagcagctggcttgctact
agcctcagcatgttttatttgctcaggattgccaatttctccaaccttatttttcttcgc
ataaagaggagagttaagagtgttgttctggtgatactgttggggcctttgctatttttg
gtttgtcatctttttgtgataaacatggatgagactgtatggacaaaagaatatgaagga
aacgtgacttggaagatcaaattgaggagtgcaatgtaccattcaaatatgactctaacc
atgctagcaaactttgtacccctcactctgaccctgatatcttttctgctgttaatctgt
tctctgtgtaaacatctcaagaagatgcagctccatggcaaaggatctcaagatcccagc
accaaggtccacataaaagctttgcaaactgtgacctcctttcttctgttatgtgccatt
tactttctgtccatgatcatatcagtttgtaattttgggaggctggaaaagcaacctgtc
ttcatgttctgccaagctattatattcagctatccttcaacccacccattcatcctgatt
ttgggaaacaagaagctaaagcagatttttctttcagttttgcggcatgtgaggtactgg
gtgaaagacagaagccttcgtctccatagattcacaagaggggcattgtgtgtcttctag

KEGG   Homo sapiens (human): 259294
Entry
259294            CDS       T01001                                 

Gene name
TAS2R19, MSTP058, T2R19, T2R23, T2R48, TAS2R23, TAS2R48
Definition
(RefSeq) taste 2 receptor member 19
  KO
K08474  taste receptor type 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04742 Taste transduction
    259294 (TAS2R19)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    259294 (TAS2R19)
G protein-coupled receptors [BR:hsa04030]
 Others
  Chemoreception
   Taste
    259294 (TAS2R19)
SSDB
Motif
Pfam: TAS2R NnrS
Other DBs
NCBI-GeneID: 259294
NCBI-ProteinID: NP_795369
OMIM: 613961
HGNC: 19108
Ensembl: ENSG00000212124
Vega: OTTHUMG00000162687
Pharos: P59542(Tdark)
UniProt: P59542
LinkDB
Position
12p13.2
AA seq 299 aa
MMCFLLIISSILVVFAFVLGNVANGFIALVNVIDWVNTRKISSAEQILTALVVSRIGLLW
VMLFLWYATVFNSALYGLEVRIVASNAWAVTNHFSMWLAASLSIFCLLKIANFSNLISLH
LKKRIKSVVLVILLGPLVFLICNLAVITMDERVWTKEYEGNVTWKIKLRNAIHLSSLTVT
TLANLIPFTLSLICFLLLICSLCKHLKKMRLHSKGSQDPSTKVHIKALQTVTSFLMLFAI
YFLCIITSTWNLRTQQSKLVLLLCQTVAIMYPSFHSFILIMGSRKLKQTFLSVLWQMTR
NT seq 900 nt   +upstreamnt  +downstreamnt
atgatgtgttttctgctcatcatttcatcaattctggtagtgtttgcatttgttcttgga
aatgttgccaatggcttcatagccctagtaaatgtcattgactgggttaacacacgaaag
atctcctcagctgagcaaattctcactgctctggtggtctccagaattggtttactctgg
gtcatgttattcctttggtatgcaactgtgtttaattctgctttatatggtttagaagta
agaattgttgcttctaatgcctgggctgtaacgaaccatttcagcatgtggcttgctgct
agcctcagcatattttgtttgctcaagattgccaatttctccaaccttatttctctccac
ctaaagaagagaattaagagtgttgttctggtgatactgttggggcccttggtatttctg
atttgtaatcttgctgtgataaccatggatgagagagtgtggacaaaagaatatgaagga
aatgtgacttggaagatcaaattgaggaatgcaatacacctttcaagcttgactgtaact
actctagcaaacctcataccctttactctgagcctaatatgttttctgctgttaatctgt
tctctttgtaaacatctcaagaagatgcggctccatagcaaaggatctcaagatcccagc
accaaggtccatataaaagctttgcaaactgtgacctccttcctcatgttatttgccatt
tactttctgtgtataatcacatcaacttggaatcttaggacacagcagagcaaacttgta
ctcctgctttgccaaactgttgcaatcatgtatccttcattccactcattcatcctgatt
atgggaagtaggaagctaaaacagacctttctttcagttttgtggcagatgacacgctga

KEGG   Homo sapiens (human): 259295
Entry
259295            CDS       T01001                                 

Gene name
TAS2R20, T2R20, T2R49, T2R56, TAS2R49
Definition
(RefSeq) taste 2 receptor member 20
  KO
K08474  taste receptor type 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04742 Taste transduction
    259295 (TAS2R20)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    259295 (TAS2R20)
G protein-coupled receptors [BR:hsa04030]
 Others
  Chemoreception
   Taste
    259295 (TAS2R20)
SSDB
Motif
Pfam: TAS2R
Other DBs
NCBI-GeneID: 259295
NCBI-ProteinID: NP_795370
OMIM: 613962
HGNC: 19109
Ensembl: ENSG00000255837
Vega: OTTHUMG00000162695
Pharos: P59543(Tbio)
UniProt: P59543
LinkDB
Position
12p13.2
AA seq 309 aa
MMSFLHIVFSILVVVAFILGNFANGFIALINFIAWVKRQKISSADQIIAALAVSRVGLLW
VILLHWYSTVLNPTSSNLKVIIFISNAWAVTNHFSIWLATSLSIFYLLKIVNFSRLIFHH
LKRKAKSVVLVIVLGSLFFLVCHLVMKHTYINVWTEECEGNVTWKIKLRNAMHLSNLTVA
MLANLIPFTLTLISFLLLIYSLCKHLKKMQLHGKGSQDPSTKIHIKALQTVTSFLILLAI
YFLCLIISFWNFKMRPKEIVLMLCQAFGIIYPSFHSFILIWGNKTLKQTFLSVLWQVTCW
AKGQNQSTP
NT seq 930 nt   +upstreamnt  +downstreamnt
atgatgagttttctacacattgttttttccattctagtagtggttgcatttattcttgga
aattttgccaatggctttatagcactgataaatttcattgcctgggtcaagagacaaaag
atctcctcagctgatcaaattattgctgctctggcagtctccagagttggtttgctctgg
gtaatattattacattggtattcaactgtgttgaatccaacttcatctaatttaaaagta
ataatttttatttctaatgcctgggcagtaaccaatcatttcagcatctggcttgctact
agcctcagcatattttatttgctcaagatcgtcaatttctccagacttatttttcatcac
ttaaaaaggaaggctaagagtgtagttctggtgatagtgttggggtctttgttctttttg
gtttgtcaccttgtgatgaaacacacgtatataaatgtgtggacagaagaatgtgaagga
aacgtaacttggaagatcaaactgaggaatgcaatgcacctttccaacttgactgtagcc
atgctagcaaacttgataccattcactctgaccctgatatcttttctgctgttaatctac
tctctgtgtaaacatctgaagaagatgcagctccatggcaaaggatctcaagatcccagc
accaagatccacataaaagctctgcaaactgtgacctccttcctcatattacttgccatt
tactttctgtgtctaatcatatcgttttggaattttaagatgcgaccaaaagaaattgtc
ttaatgctttgccaagcttttggaatcatatatccatcattccactcattcattctgatt
tgggggaacaagacgctaaagcagacctttctttcagttttgtggcaggtgacttgctgg
gcaaaaggacagaaccagtcaactccatag

KEGG   Homo sapiens (human): 259296
Entry
259296            CDS       T01001                                 

Gene name
TAS2R50, T2R50, T2R51, TAS2R51
Definition
(RefSeq) taste 2 receptor member 50
  KO
K08474  taste receptor type 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04742 Taste transduction
    259296 (TAS2R50)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    259296 (TAS2R50)
G protein-coupled receptors [BR:hsa04030]
 Others
  Chemoreception
   Taste
    259296 (TAS2R50)
SSDB
Motif
Pfam: TAS2R
Other DBs
NCBI-GeneID: 259296
NCBI-ProteinID: NP_795371
OMIM: 609627
HGNC: 18882
Ensembl: ENSG00000212126
Vega: OTTHUMG00000162719
Pharos: P59544(Tbio)
UniProt: P59544
LinkDB
Position
12p13.2
AA seq 299 aa
MITFLYIFFSILIMVLFVLGNFANGFIALVNFIDWVKRKKISSADQILTALAVSRIGLLW
ALLLNWYLTVLNPAFYSVELRITSYNAWVVTNHFSMWLAANLSIFYLLKIANFSNLLFLH
LKRRVRSVILVILLGTLIFLVCHLLVANMDESMWAEEYEGNMTGKMKLRNTVHLSYLTVT
TLWSFIPFTLSLISFLMLICSLCKHLKKMQLHGEGSQDLSTKVHIKALQTLISFLLLCAI
FFLFLIVSVWSPRRLRNDPVVMVSKAVGNIYLAFDSFILIWRTKKLKHTFLLILCQIRC
NT seq 900 nt   +upstreamnt  +downstreamnt
atgataacttttctatacatttttttttcaattctaataatggttttatttgttctcgga
aactttgccaatggcttcatagcactggtaaatttcattgactgggtgaagagaaaaaag
atctcctcagctgaccaaattctcactgctctggcggtctccagaattggtttgctctgg
gcattattattaaattggtatttaactgtgttgaatccagctttttatagtgtagaatta
agaattacttcttataatgcctgggttgtaaccaaccatttcagcatgtggcttgctgct
aacctcagcatattttatttgctcaagattgccaatttctccaaccttctttttcttcat
ttaaagaggagagttaggagtgtcattctggtgatactgttggggactttgatatttttg
gtttgtcatcttcttgtggcaaacatggatgagagtatgtgggcagaagaatatgaagga
aacatgactgggaagatgaaattgaggaatacagtacatctttcatatttgactgtaact
accctatggagcttcataccctttactctgtccctgatatcttttctgatgctaatctgt
tctctgtgtaaacatctcaagaagatgcagctccatggagaaggatcgcaagatctcagc
accaaggtccacataaaagctttgcaaactctgatctccttcctcttgttatgtgccatt
ttctttctattcctaatcgtttcggtttggagtcctaggaggctgcggaatgacccggtt
gtcatggttagcaaggctgttggaaacatatatcttgcattcgactcattcatcctaatt
tggagaaccaagaagctaaaacacacctttcttttgattttgtgtcagattaggtgctga

KEGG   Homo sapiens (human): 338398
Entry
338398            CDS       T01001                                 

Gene name
TAS2R60, T2R56, T2R60
Definition
(RefSeq) taste 2 receptor member 60
  KO
K08474  taste receptor type 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04742 Taste transduction
    338398 (TAS2R60)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    338398 (TAS2R60)
G protein-coupled receptors [BR:hsa04030]
 Others
  Chemoreception
   Taste
    338398 (TAS2R60)
SSDB
Motif
Pfam: TAS2R
Other DBs
NCBI-GeneID: 338398
NCBI-ProteinID: NP_803186
OMIM: 613968
HGNC: 20639
Ensembl: ENSG00000185899
Vega: OTTHUMG00000154891
Pharos: P59551(Tbio)
UniProt: P59551
LinkDB
Position
7q35
AA seq 318 aa
MNGDHMVLGSSVTDKKAIILVTILLLLRLVAIAGNGFITAALGVEWVLRRMLLPCDKLLV
SLGASRFCLQSVVMGKTIYVFLHPMAFPYNPVLQFLAFQWDFLNAATLWSSTWLSVFYCV
KIATFTHPVFFWLKHKLSGWLPWMLFSSVGLSSFTTILFFIGNHRMYQNYLRNHLQPWNV
TGDSIRSYCEKFYLFPLKMITWTMPTAVFFICMILLITSLGRHRKKALLTTSGFREPSVQ
AHIKALLALLSFAMLFISYFLSLVFSAAGIFPPLDFKFWVWESVIYLCAAVHPIILLFSN
CRLRAVLKSRRSSRCGTP
NT seq 957 nt   +upstreamnt  +downstreamnt
atgaatggagaccacatggttctaggatcttcggtgactgacaagaaggccatcatcttg
gttaccattttactccttttacgcctggtagcaatagcaggcaatggcttcatcactgct
gctctgggcgtggagtgggtgctacggagaatgttgttgccttgtgataagttattggtt
agcctaggggcctctcgcttctgtctgcagtcagtggtaatgggtaagaccatttatgtt
ttcttgcatccgatggccttcccatacaaccctgtactgcagtttctagctttccagtgg
gacttcctgaatgctgccaccttatggtcctctacctggctcagtgtcttctattgtgtg
aaaattgctaccttcacccaccctgtcttcttctggctaaagcacaagttgtctgggtgg
ctaccatggatgctcttcagctctgtagggctctccagcttcaccaccattctatttttc
ataggcaaccacagaatgtatcagaactatttaaggaaccatctacaaccttggaatgtc
actggcgatagcatacggagctactgtgagaaattctatctcttccctctaaaaatgatt
acttggacaatgcccactgctgtctttttcatttgcatgattttgctcatcacatctctg
ggaagacacaggaagaaggctctccttacaacctcaggattccgagagcccagtgtgcag
gcacacataaaggctctgctggctctcctctcttttgccatgctcttcatctcatatttc
ctgtcactggtgttcagtgctgcaggtatttttccacctctggactttaaattctgggtg
tgggagtcagtgatttatctgtgtgcagcagttcaccccatcattctgctcttcagcaac
tgcaggctgagagctgtgctgaagagtcgtcgttcctcaaggtgtgggacaccttga

KEGG   Homo sapiens (human): 353164
Entry
353164            CDS       T01001                                 

Gene name
TAS2R42, T2R24, T2R42, T2R55, TAS2R55
Definition
(RefSeq) taste 2 receptor member 42
  KO
K08474  taste receptor type 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04742 Taste transduction
    353164 (TAS2R42)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    353164 (TAS2R42)
G protein-coupled receptors [BR:hsa04030]
 Others
  Chemoreception
   Taste
    353164 (TAS2R42)
SSDB
Motif
Pfam: TAS2R
Other DBs
NCBI-GeneID: 353164
NCBI-ProteinID: NP_852094
OMIM: 613966
HGNC: 18888
Ensembl: ENSG00000186136
Vega: OTTHUMG00000168567
UniProt: A0A0G2JPZ2
LinkDB
Position
12p13.2
AA seq 314 aa
MATELDKIFLILAIAEFIISMLGNVFIGLVNCSEGIKNQKVFSADFILTCLAISTIGQLL
VILFDSFLVGLASHLYTTYRLGKTVIMLWHMTNHLTTWLATCLSIFYFFKIAHFPHSLFL
WLRWRMNGMIVMLLILSLFLLIFDSLVLEIFIDISLNIIDKSNLTLYLDESKTLYDKLSI
LKTLLSLTSFIPFSLFLTSLLFLFLSLVRHTRNLKLSSLGSRDSSTEAHRRAMKMVMSFL
FLFIVHFFSLQVANWIFFMLWNNKCIKFVMLALNAFPSCHSFILILGNSKLQQTAVRLLW
HLRNYTKTPNPLPL
NT seq 945 nt   +upstreamnt  +downstreamnt
atggccaccgaattggacaaaatctttctgattctggcaatagcagaattcatcatcagc
atgctggggaatgtgttcattggactggtaaactgctctgaagggatcaagaaccaaaag
gtcttctcagctgacttcatcctcacctgcttggctatctccacaattggacaactgttg
gtgatactgtttgattcatttctagtgggacttgcttcacatttatataccacatataga
ctaggaaaaactgttattatgctttggcacatgactaatcacttgacaacctggcttgcc
acctgcctaagcattttctatttctttaagatagcccacttcccccactcccttttcctc
tggctgaggtggaggatgaacggaatgattgttatgcttcttatattgtctttgttctta
ctgatttttgacagtttagtgctagaaatatttattgatatctcactcaatataatagat
aaaagtaatctgactttatatttagatgaaagtaaaactctctatgataaactctctatt
ttaaaaactcttctcagcttgaccagttttatccccttttctctgttcctgacctccttg
ctttttttatttctgtccttggtgagacatactagaaatttgaagctcagttccttgggc
tctagagactccagcacagaggcccataggagggccatgaaaatggtgatgtctttcctt
ttcctcttcatagttcattttttttccttacaagtggccaattggatattttttatgttg
tggaacaacaagtgcataaagtttgtcatgttagccttaaatgcctttccctcgtgccac
tcatttattctcattctgggaaacagcaagctgcaacagacagctgtgaggctactgtgg
catcttaggaactatacaaaaacaccaaaccctttacctttgtag

KEGG   Homo sapiens (human): 50831
Entry
50831             CDS       T01001                                 

Gene name
TAS2R3, T2R3
Definition
(RefSeq) taste 2 receptor member 3
  KO
K08474  taste receptor type 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04742 Taste transduction
    50831 (TAS2R3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    50831 (TAS2R3)
G protein-coupled receptors [BR:hsa04030]
 Others
  Chemoreception
   Taste
    50831 (TAS2R3)
SSDB
Motif
Pfam: TAS2R 7tm_1
Other DBs
NCBI-GeneID: 50831
NCBI-ProteinID: NP_058639
OMIM: 604868
HGNC: 14910
Ensembl: ENSG00000127362
Vega: OTTHUMG00000157637
Pharos: Q9NYW6(Tbio)
UniProt: Q9NYW6
LinkDB
Position
7q34
AA seq 316 aa
MMGLTEGVFLILSGTQFTLGILVNCFIELVNGSSWFKTKRMSLSDFIITTLALLRIILLC
IILTDSFLIEFSPNTHDSGIIMQIIDVSWTFTNHLSIWLATCLGVLYCLKIASFSHPTFL
WLKWRVSRVMVWMLLGALLLSCGSTASLINEFKLYSVFRGIEATRNVTEHFRKKRSEYYL
IHVLGTLWYLPPLIVSLASYSLLIFSLGRHTRQMLQNGTSSRDPTTEAHKRAIRIILSFF
FLFLLYFLAFLIASFGNFLPKTKMAKMIGEVMTMFYPAGHSFILILGNSKLKQTFVVMLR
CESGHLKPGSKGPIFS
NT seq 951 nt   +upstreamnt  +downstreamnt
atgatgggactcaccgagggggtgttcctgattctgtctggcactcagttcacactggga
attctggtcaattgtttcattgagttggtcaatggtagcagctggttcaagaccaagaga
atgtctttgtctgacttcatcatcaccaccctggcactcttgaggatcattctgctgtgt
attatcttgactgatagttttttaatagaattctctcccaacacacatgattcagggata
ataatgcaaattattgatgtttcctggacatttacaaaccatctgagcatttggcttgcc
acctgtcttggtgtcctctactgcctgaaaatcgccagtttctctcaccccacattcctc
tggctcaagtggagagtttctagggtgatggtatggatgctgttgggtgcactgctctta
tcctgtggtagtaccgcatctctgatcaatgagtttaagctctattctgtctttagggga
attgaggccaccaggaatgtgactgaacacttcagaaagaagaggagtgagtattatctg
atccatgttcttgggactctgtggtacctgcctcccttaattgtgtccctggcctcctac
tctttgctcatcttctccctggggaggcacacacggcagatgctgcaaaatgggacaagc
tccagagatccaaccactgaggcccacaagagggccatcagaatcatcctttccttcttc
tttctcttcttactttactttcttgctttcttaattgcatcatttggtaatttcctacca
aaaaccaagatggctaagatgattggcgaagtaatgacaatgttttatcctgctggccac
tcatttattctcattctggggaacagtaagctgaagcagacatttgtagtgatgctccgg
tgtgagtctggtcatctgaagcctggatccaagggacccattttctcttag

KEGG   Homo sapiens (human): 50832
Entry
50832             CDS       T01001                                 

Gene name
TAS2R4, T2R4
Definition
(RefSeq) taste 2 receptor member 4
  KO
K08474  taste receptor type 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04742 Taste transduction
    50832 (TAS2R4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    50832 (TAS2R4)
G protein-coupled receptors [BR:hsa04030]
 Others
  Chemoreception
   Taste
    50832 (TAS2R4)
SSDB
Motif
Pfam: TAS2R
Other DBs
NCBI-GeneID: 50832
NCBI-ProteinID: NP_058640
OMIM: 604869
HGNC: 14911
Ensembl: ENSG00000127364
Vega: OTTHUMG00000157634
Pharos: Q9NYW5(Tbio)
UniProt: Q9NYW5
LinkDB
Position
7q34
AA seq 299 aa
MLRLFYFSAIIASVILNFVGIIMNLFITVVNCKTWVKSHRISSSDRILFSLGITRFLMLG
LFLVNTIYFVSSNTERSVYLSAFFVLCFMFLDSSSVWFVTLLNILYCVKITNFQHSVFLL
LKRNISPKIPRLLLACVLISAFTTCLYITLSQASPFPELVTTRNNTSFNISEGILSLVVS
LVLSSSLQFIINVTSASLLIHSLRRHIQKMQKNATGFWNPQTEAHVGAMKLMVYFLILYI
PYSVATLVQYLPFYAGMDMGTKSICLIFATLYSPGHSVLIIITHPKLKTTAKKILCFKK
NT seq 900 nt   +upstreamnt  +downstreamnt
atgcttcggttattctatttctctgctattattgcctcagttattttaaattttgtagga
atcattatgaatctgtttattacagtggtcaattgcaaaacttgggtcaaaagccataga
atctcctcttctgataggattctgttcagcctgggcatcaccaggtttcttatgctggga
ctatttctggtgaacaccatctacttcgtctcttcaaatacggaaaggtcagtctacctg
tctgctttttttgtgttgtgtttcatgtttttggactcgagcagtgtctggtttgtgacc
ttgctcaatatcttgtactgtgtgaagattactaacttccaacactcagtgtttctcctg
ctgaagcggaatatctccccaaagatccccaggctgctgctggcctgtgtgctgatttct
gctttcaccacttgcctgtacatcacgcttagccaggcatcaccttttcctgaacttgtg
actacgagaaataacacatcatttaatatcagtgagggcatcttgtctttagtggtttct
ttggtcttgagctcatctctccagttcatcattaatgtgacttctgcttccttgctaata
cactccttgaggagacatatacagaagatgcagaaaaatgccactggtttctggaatccc
cagacggaagctcatgtaggtgctatgaagctgatggtctatttcctcatcctctacatt
ccatattcagttgctaccctggtccagtatctccccttttatgcagggatggatatgggg
accaaatccatttgtctgatttttgccaccctttactctccaggacattctgttctcatt
attatcacacatcctaaactgaaaacaacagcaaagaagattctttgtttcaaaaaatag

KEGG   Homo sapiens (human): 50833
Entry
50833             CDS       T01001                                 

Gene name
TAS2R16, BGLPT, T2R16
Definition
(RefSeq) taste 2 receptor member 16
  KO
K08474  taste receptor type 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04742  Taste transduction
Disease
H01611  Alcohol dependence
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04742 Taste transduction
    50833 (TAS2R16)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    50833 (TAS2R16)
G protein-coupled receptors [BR:hsa04030]
 Others
  Chemoreception
   Taste
    50833 (TAS2R16)
SSDB
Motif
Pfam: TAS2R
Other DBs
NCBI-GeneID: 50833
NCBI-ProteinID: NP_058641
OMIM: 604867
HGNC: 14921
Ensembl: ENSG00000128519
Vega: OTTHUMG00000157090
Pharos: Q9NYV7(Tbio)
UniProt: Q9NYV7
LinkDB
Position
7q31.32; 7q31
AA seq 291 aa
MIPIQLTVFFMIIYVLESLTIIVQSSLIVAVLGREWLQVRRLMPVDMILISLGISRFCLQ
WASMLNNFCSYFNLNYVLCNLTITWEFFNILTFWLNSLLTVFYCIKVSSFTHHIFLWLRW
RILRLFPWILLGSLMITCVTIIPSAIGNYIQIQLLTMEHLPRNSTVTDKLENFHQYQFQA
HTVALVIPFILFLASTIFLMASLTKQIQHHSTGHCNPSMKARFTALRSLAVLFIVFTSYF
LTILITIIGTLFDKRCWLWVWEAFVYAFILMHSTSLMLSSPTLKRILKGKC
NT seq 876 nt   +upstreamnt  +downstreamnt
atgatacccatccaactcactgtcttcttcatgatcatctatgtgcttgagtccttgaca
attattgtgcagagcagcctaattgttgcagtgctgggcagagaatggctgcaagtcaga
aggctgatgcctgtggacatgattctcatcagcctgggcatctctcgcttctgtctacag
tgggcatcaatgctgaacaatttttgctcctattttaatttgaattatgtactttgcaac
ttaacaatcacctgggaattttttaatatccttacattctggttaaacagcttgcttacc
gtgttctactgcatcaaggtctcttctttcacccatcacatctttctctggctgaggtgg
agaattttgaggttgtttccctggatattactgggttctctgatgattacttgtgtaaca
atcatcccttcagctattgggaattacattcaaattcagttactcaccatggagcatcta
ccaagaaacagcactgtaactgacaaacttgaaaattttcatcagtatcagttccaggct
catacagttgcattggttattcctttcatcctgttcctggcctccaccatctttctcatg
gcatcactgaccaagcagatacaacatcatagcactggtcactgcaatccaagcatgaaa
gcgcgcttcactgccctgaggtcccttgccgtcttatttattgtgtttacctcttacttt
ctaaccatactcatcaccattataggtactctatttgataagagatgttggttatgggtc
tgggaagcttttgtctatgctttcatcttaatgcattccacttcactgatgctgagcagc
cctacgttgaaaaggattctaaagggaaagtgctag

KEGG   Homo sapiens (human): 50834
Entry
50834             CDS       T01001                                 

Gene name
TAS2R1, T2R1, TRB7
Definition
(RefSeq) taste 2 receptor member 1
  KO
K08474  taste receptor type 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04742 Taste transduction
    50834 (TAS2R1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    50834 (TAS2R1)
G protein-coupled receptors [BR:hsa04030]
 Others
  Chemoreception
   Taste
    50834 (TAS2R1)
SSDB
Motif
Pfam: TAS2R
Other DBs
NCBI-GeneID: 50834
NCBI-ProteinID: NP_062545
OMIM: 604796
HGNC: 14909
Ensembl: ENSG00000169777
Vega: OTTHUMG00000090500
Pharos: Q9NYW7(Tbio)
UniProt: Q9NYW7 Q502V6
LinkDB
Position
5p15.31
AA seq 299 aa
MLESHLIIYFLLAVIQFLLGIFTNGIIVVVNGIDLIKHRKMAPLDLLLSCLAVSRIFLQL
FIFYVNVIVIFFIEFIMCSANCAILLFINELELWLATWLGVFYCAKVASVRHPLFIWLKM
RISKLVPWMILGSLLYVSMICVFHSKYAGFMVPYFLRKFFSQNATIQKEDTLAIQIFSFV
AEFSVPLLIFLFAVLLLIFSLGRHTRQMRNTVAGSRVPGRGAPISALLSILSFLILYFSH
CMIKVFLSSLKFHIRRFIFLFFILVIGIYPSGHSLILILGNPKLKQNAKKFLLHSKCCQ
NT seq 900 nt   +upstreamnt  +downstreamnt
atgctagagtctcacctcattatctattttcttcttgcagtgatacaatttcttcttggg
attttcacaaatggcatcattgtggtggtgaatggcattgacttgatcaagcacagaaaa
atggctccgctggatctccttctttcttgtctggcagtttctagaatttttctgcagttg
ttcatcttctacgttaatgtgattgttatcttcttcatagaattcatcatgtgttctgcg
aattgtgcaattctcttatttataaatgaattggaactttggcttgccacatggctcggc
gttttctattgtgccaaggttgccagcgtccgtcacccactcttcatctggttgaagatg
aggatatccaagctggtcccatggatgatcctggggtctctgctatatgtatctatgatt
tgtgttttccatagcaaatatgcagggtttatggtcccatacttcctaaggaaatttttc
tcccaaaatgccacaattcaaaaagaagatacactggctatacagattttctcttttgtt
gctgagttctcagtgccattgcttatcttcctttttgctgttttgctcttgattttctct
ctggggaggcacacccggcaaatgagaaacacagtggccggcagcagggttcctggcagg
ggtgcacccatcagcgcgttgctgtctatcctgtccttcctgatcctctacttctcccac
tgcatgataaaagtttttctctcttctctaaagtttcacatcagaaggttcatctttctg
ttcttcatccttgtgattggtatatacccttctggacactctctcatcttaattttagga
aatcctaaattgaaacaaaatgcaaaaaagttcctcctccacagtaagtgctgtcagtga

KEGG   Homo sapiens (human): 50835
Entry
50835             CDS       T01001                                 

Gene name
TAS2R9, T2R9, TRB6
Definition
(RefSeq) taste 2 receptor member 9
  KO
K08474  taste receptor type 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04742 Taste transduction
    50835 (TAS2R9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    50835 (TAS2R9)
G protein-coupled receptors [BR:hsa04030]
 Others
  Chemoreception
   Taste
    50835 (TAS2R9)
SSDB
Motif
Pfam: TAS2R
Other DBs
NCBI-GeneID: 50835
NCBI-ProteinID: NP_076406
OMIM: 604795
HGNC: 14917
Ensembl: ENSG00000121381
Vega: OTTHUMG00000168507
Pharos: Q9NYW1(Tdark)
UniProt: Q9NYW1
LinkDB
Position
12p13.2
AA seq 312 aa
MPSAIEAIYIILIAGELTIGIWGNGFIVLVNCIDWLKRRDISLIDIILISLAISRICLLC
VISLDGFFMLLFPGTYGNSVLVSIVNVVWTFANNSSLWFTSCLSIFYLLKIANISHPFFF
WLKLKINKVMLAILLGSFLISLIISVPKNDDMWYHLFKVSHEENITWKFKVSKIPGTFKQ
LTLNLGVMVPFILCLISFFLLLFSLVRHTKQIRLHATGFRDPSTEAHMRAIKAVIIFLLL
LIVYYPVFLVMTSSALIPQGKLVLMIGDIVTVIFPSSHSFILIMGNSKLREAFLKMLRFV
KCFLRRRKPFVP
NT seq 939 nt   +upstreamnt  +downstreamnt
atgccaagtgcaatagaggcaatatatattattttaattgctggtgaattgaccataggg
atttggggaaatggattcattgtactagttaactgcattgactggctcaaaagaagagat
atttccttgattgacatcatcctgatcagcttggccatctccagaatctgtctgctgtgt
gtaatatcattagatggcttctttatgctgctctttccaggtacatatggcaatagcgtg
ctagtaagcattgtgaatgttgtctggacatttgccaataattcaagtctctggtttact
tcttgcctcagtatcttctatttactcaagatagccaatatatcgcacccatttttcttc
tggctgaagctaaagatcaacaaggtcatgcttgcgattcttctggggtcctttcttatc
tctttaattattagtgttccaaagaatgatgatatgtggtatcaccttttcaaagtcagt
catgaagaaaacattacttggaaattcaaagtgagtaaaattccaggtactttcaaacag
ttaaccctgaacctgggggtgatggttccctttatcctttgcctgatctcatttttcttg
ttacttttctccctagttagacacaccaagcagattcgactgcatgctacagggttcaga
gaccccagtacagaggcccacatgagggccataaaggcagtgatcatctttctgctcctc
ctcatcgtgtactacccagtctttcttgttatgacctctagcgctctgattcctcaggga
aaattagtgttgatgattggtgacatagtaactgtcattttcccatcaagccattcattc
attctaattatgggaaatagcaagttgagggaagcttttctgaagatgttaagatttgtg
aagtgtttccttagaagaagaaagccttttgttccatag

KEGG   Homo sapiens (human): 50836
Entry
50836             CDS       T01001                                 

Gene name
TAS2R8, T2R8, TRB5
Definition
(RefSeq) taste 2 receptor member 8
  KO
K08474  taste receptor type 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04742 Taste transduction
    50836 (TAS2R8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    50836 (TAS2R8)
G protein-coupled receptors [BR:hsa04030]
 Others
  Chemoreception
   Taste
    50836 (TAS2R8)
SSDB
Motif
Pfam: TAS2R
Other DBs
NCBI-GeneID: 50836
NCBI-ProteinID: NP_076407
OMIM: 604794
HGNC: 14915
Ensembl: ENSG00000121314
Vega: OTTHUMG00000168506
Pharos: Q9NYW2(Tbio)
UniProt: Q9NYW2
LinkDB
Position
12p13.2
AA seq 309 aa
MFSPADNIFIILITGEFILGILGNGYIALVNWIDWIKKKKISTVDYILTNLVIARICLIS
VMVVNGIVIVLNPDVYTKNKQQIVIFTFWTFANYLNMWITTCLNVFYFLKIASSSHPLFL
WLKWKIDMVVHWILLGCFAISLLVSLIAAIVLSCDYRFHAIAKHKRNITEMFHVSKIPYF
EPLTLFNLFAIVPFIVSLISFFLLVRSLWRHTKQIKLYATGSRDPSTEVHVRAIKTMTSF
IFFFFLYYISSILMTFSYLMTKYKLAVEFGEIAAILYPLGHSLILIVLNNKLRQTFVRML
TCRKIACMI
NT seq 930 nt   +upstreamnt  +downstreamnt
atgttcagtcctgcagataacatctttataatcctaataactggagaattcatactagga
atattggggaatggatacattgcactagtcaactggattgactggattaagaagaaaaag
atttccacagttgactacatccttaccaatttagttatcgccagaatttgtttgatcagt
gtaatggttgtaaatggcattgtaatagtactgaacccagatgtttatacaaaaaataaa
caacagatagtcatttttaccttctggacatttgccaactacttaaatatgtggattacc
acctgccttaatgtcttctattttctgaagatagccagttcctctcatccactttttctc
tggctgaagtggaaaattgatatggtggtgcactggatcctgctgggatgctttgccatt
tccttgttggtcagccttatagcagcaatagtactgagttgtgattataggtttcatgca
attgccaaacataaaagaaacattactgaaatgttccatgtgagtaaaataccatacttt
gaacccttgactctctttaacctgtttgcaattgtcccatttattgtgtcactgatatca
tttttccttttagtaagatctttatggagacataccaagcaaataaaactctatgctacc
ggcagtagagaccccagcacagaagttcatgtgagagccattaaaactatgacttcattt
atcttcttttttttcctatactatatttcttctattttgatgacctttagctatcttatg
acaaaatacaagttagctgtggagtttggagagattgcagcaattctctaccccttgggt
cactcacttattttaattgttttaaataataaactgaggcagacatttgtcagaatgctg
acatgtagaaaaattgcctgcatgatatga

KEGG   Homo sapiens (human): 50837
Entry
50837             CDS       T01001                                 

Gene name
TAS2R7, T2R7, TRB4
Definition
(RefSeq) taste 2 receptor member 7
  KO
K08474  taste receptor type 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04742 Taste transduction
    50837 (TAS2R7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    50837 (TAS2R7)
G protein-coupled receptors [BR:hsa04030]
 Others
  Chemoreception
   Taste
    50837 (TAS2R7)
SSDB
Motif
Pfam: TAS2R
Other DBs
NCBI-GeneID: 50837
NCBI-ProteinID: NP_076408
OMIM: 604793
HGNC: 14913
Ensembl: ENSG00000121377
Vega: OTTHUMG00000168505
Pharos: Q9NYW3(Tbio)
UniProt: Q9NYW3
LinkDB
Position
12p13.2
AA seq 318 aa
MADKVQTTLLFLAVGEFSVGILGNAFIGLVNCMDWVKKRKIASIDLILTSLAISRICLLC
VILLDCFILVLYPDVYATGKEMRIIDFFWTLTNHLSIWFATCLSIYYFFKIGNFFHPLFL
WMKWRIDRVISWILLGCVVLSVFISLPATENLNADFRFCVKAKRKTNLTWSCRVNKTQHA
STKLFLNLATLLPFCVCLMSFFLLILSLRRHIRRMQLSATGCRDPSTEAHVRALKAVISF
LLLFIAYYLSFLIATSSYFMPETELAVIFGESIALIYPSSHSFILILGNNKLRHASLKVI
WKVMSILKGRKFQQHKQI
NT seq 957 nt   +upstreamnt  +downstreamnt
atggcagataaagtgcagactactttattgttcttagcagttggagagttttcagtgggg
atcttagggaatgcattcattggattggtaaactgcatggactgggtcaagaagaggaaa
attgcctccattgatttaatcctcacaagtctggccatatccagaatttgtctattgtgc
gtaatactattagattgttttatattggtgctatatccagatgtctatgccactggtaaa
gaaatgagaatcattgacttcttctggacactaaccaatcatttaagtatctggtttgca
acctgcctcagcatttactatttcttcaagataggtaatttctttcacccacttttcctc
tggatgaagtggagaattgacagggtgatttcctggattctactggggtgcgtggttctc
tctgtgtttattagccttccagccactgagaatttgaacgctgatttcaggttttgtgtg
aaggcaaagaggaaaacaaacttaacttggagttgcagagtaaataaaactcaacatgct
tctaccaagttatttctcaacctggcaacgctgctccccttttgtgtgtgcctaatgtcc
tttttcctcttgatcctctccctgcggagacatatcaggcgaatgcagctcagtgccaca
gggtgcagagaccccagcacagaagcccatgtgagagccctgaaagctgtcatttccttc
cttctcctctttattgcctactatttgtcctttctcattgccacctccagctactttatg
ccagagacggaattagctgtgatttttggtgagtccatagctctaatctacccctcaagt
cattcatttatcctaatactggggaacaataaattaagacatgcatctctaaaggtgatt
tggaaagtaatgtctattctaaaaggaagaaaattccaacaacataaacaaatctga

KEGG   Homo sapiens (human): 50838
Entry
50838             CDS       T01001                                 

Gene name
TAS2R13, T2R13, TRB3
Definition
(RefSeq) taste 2 receptor member 13
  KO
K08474  taste receptor type 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04742 Taste transduction
    50838 (TAS2R13)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    50838 (TAS2R13)
G protein-coupled receptors [BR:hsa04030]
 Others
  Chemoreception
   Taste
    50838 (TAS2R13)
SSDB
Motif
Pfam: TAS2R DUF1280
Other DBs
NCBI-GeneID: 50838
NCBI-ProteinID: NP_076409
OMIM: 604792
HGNC: 14919
Ensembl: ENSG00000212128
Vega: OTTHUMG00000168555
Pharos: Q9NYV9(Tbio)
UniProt: Q9NYV9
LinkDB
Position
12p13.2
AA seq 303 aa
MESALPSIFTLVIIAEFIIGNLSNGFIVLINCIDWVSKRELSSVDKLLIILAISRIGLIW
EILVSWFLALHYLAIFVSGTGLRIMIFSWIVSNHFNLWLATIFSIFYLLKIASFSSPAFL
YLKWRVNKVILMILLGTLVFLFLNLIQINMHIKDWLDRYERNTTWNFSMSDFETFSVSVK
FTMTMFSLTPFTVAFISFLLLIFSLQKHLQKMQLNYKGHRDPRTKVHTNALKIVISFLLF
YASFFLCVLISWISELYQNTVIYMLCETIGVFSPSSHSFLLILGNAKLRQAFLLVAAKVW
AKR
NT seq 912 nt   +upstreamnt  +downstreamnt
atggaaagtgccctgccgagtatcttcactcttgtaataattgcagaattcataattggg
aatttgagcaatggatttatagtactgatcaactgcattgactgggtcagtaaaagagag
ctgtcctcagtcgataaactcctcattatcttggcaatctccagaattgggctgatctgg
gaaatattagtaagttggtttttagctctgcattatctagccatatttgtgtctggaaca
ggattaagaattatgatttttagctggatagtttctaatcacttcaatctctggcttgct
acaatcttcagcatcttttatttgctcaaaatagcgagtttctctagccctgcttttctc
tatttgaagtggagagtaaacaaagtgattctgatgatactgctaggaaccttggtcttc
ttatttttaaatctgatacaaataaacatgcatataaaagactggctggaccgatatgaa
agaaacacaacttggaatttcagtatgagtgactttgaaacattttcagtgtcggtcaaa
ttcactatgactatgttcagtctaacaccatttactgtggccttcatctcttttctcctg
ttaattttctccctgcagaaacatctccagaaaatgcaactcaattacaaaggacacaga
gaccccaggaccaaggtccatacaaatgccttgaaaattgtgatctcattccttttattc
tatgctagtttctttctatgtgttctcatatcatggatttctgagctgtatcagaacaca
gtgatctacatgctttgtgagacgattggagtcttctctccttcaagccactcctttctt
ctgattctaggaaacgctaagttaagacaggcctttcttttggtggcagctaaggtatgg
gctaaacgatga

KEGG   Homo sapiens (human): 50839
Entry
50839             CDS       T01001                                 

Gene name
TAS2R10, T2R10, TRB2
Definition
(RefSeq) taste 2 receptor member 10
  KO
K08474  taste receptor type 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04742 Taste transduction
    50839 (TAS2R10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    50839 (TAS2R10)
G protein-coupled receptors [BR:hsa04030]
 Others
  Chemoreception
   Taste
    50839 (TAS2R10)
SSDB
Motif
Pfam: TAS2R
Other DBs
NCBI-GeneID: 50839
NCBI-ProteinID: NP_076410
OMIM: 604791
HGNC: 14918
Ensembl: ENSG00000121318
Vega: OTTHUMG00000168508
Pharos: Q9NYW0(Tbio)
UniProt: Q9NYW0
LinkDB
Position
12p13.2
AA seq 307 aa
MLRVVEGIFIFVVVSESVFGVLGNGFIGLVNCIDCAKNKLSTIGFILTGLAISRIFLIWI
IITDGFIQIFSPNIYASGNLIEYISYFWVIGNQSSMWFATSLSIFYFLKIANFSNYIFLW
LKSRTNMVLPFMIVFLLISSLLNFAYIAKILNDYKTKNDTVWDLNMYKSEYFIKQILLNL
GVIFFFTLSLITCIFLIISLWRHNRQMQSNVTGLRDSNTEAHVKAMKVLISFIILFILYF
IGMAIEISCFTVRENKLLLMFGMTTTAIYPWGHSFILILGNSKLKQASLRVLQQLKCCEK
RKNLRVT
NT seq 924 nt   +upstreamnt  +downstreamnt
atgctacgtgtagtggaaggcatcttcatttttgttgtagttagtgagtcagtgtttggg
gttttggggaatggatttattggacttgtaaactgcattgactgtgccaagaataagtta
tctacgattggctttattctcaccggcttagctatttcaagaatttttctgatatggata
ataattacagatggatttatacagatattctctccaaatatatatgcctccggtaaccta
attgaatatattagttacttttgggtaattggtaatcaatcaagtatgtggtttgccacc
agcctcagcatcttctatttcctgaagatagcaaatttttccaactacatatttctctgg
ttgaagagcagaacaaatatggttcttcccttcatgatagtattcttacttatttcatcg
ttacttaattttgcatacattgcgaagattcttaatgattataaaacgaagaatgacaca
gtctgggatctcaacatgtataaaagtgaatactttattaaacagattttgctaaatctg
ggagtcattttcttctttacactatccctaattacatgtatttttttaatcatttccctt
tggagacacaacaggcagatgcaatcgaatgtgacaggattgagagactccaacacagaa
gctcatgtgaaggcaatgaaagttttgatatctttcatcatcctctttatcttgtatttt
ataggcatggccatagaaatatcatgttttactgtgcgagaaaacaaactgctgcttatg
tttggaatgacaaccacagccatctatccctggggtcactcatttatcttaattctagga
aacagcaagctaaagcaagcctctttgagggtactgcagcaattgaagtgctgtgagaaa
aggaaaaatctcagagtcacatag

KEGG   Homo sapiens (human): 50840
Entry
50840             CDS       T01001                                 

Gene name
TAS2R14, T2R14, TRB1
Definition
(RefSeq) taste 2 receptor member 14
  KO
K08474  taste receptor type 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04742 Taste transduction
    50840 (TAS2R14)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    50840 (TAS2R14)
G protein-coupled receptors [BR:hsa04030]
 Others
  Chemoreception
   Taste
    50840 (TAS2R14)
SSDB
Motif
Pfam: TAS2R
Other DBs
NCBI-GeneID: 50840
NCBI-ProteinID: NP_076411
OMIM: 604790
HGNC: 14920
Ensembl: ENSG00000212127
Vega: OTTHUMG00000162720
Pharos: Q9NYV8(Tbio)
UniProt: Q9NYV8
LinkDB
Position
12p13.2
AA seq 317 aa
MGGVIKSIFTFVLIVEFIIGNLGNSFIALVNCIDWVKGRKISSVDRILTALAISRISLVW
LIFGSWCVSVFFPALFATEKMFRMLTNIWTVINHFSVWLATGLGTFYFLKIANFSNSIFL
YLKWRVKKVVLVLLLVTSVFLFLNIALINIHINASINGYRRNKTCSSDSSNFTRFSSLIV
LTSTVFIFIPFTLSLAMFLLLIFSMWKHRKKMQHTVKISGDASTKAHRGVKSVITFFLLY
AIFSLSFFISVWTSERLEENLIILSQVMGMAYPSCHSCVLILGNKKLRQASLSVLLWLRY
MFKDGEPSGHKEFRESS
NT seq 954 nt   +upstreamnt  +downstreamnt
atgggtggtgtcataaagagcatatttacattcgttttaattgtggaatttataattgga
aatttaggaaatagtttcatagcactggtgaactgtattgactgggtcaagggaagaaag
atctcttcggttgatcggatcctcactgctttggcaatctctcgaattagcctggtttgg
ttaatattcggaagctggtgtgtgtctgtgtttttcccagctttatttgccactgaaaaa
atgttcagaatgcttactaatatctggacagtgatcaatcattttagtgtctggttagct
acaggcctcggtactttttattttctcaagatagccaatttttctaactctatttttctc
tacctaaagtggagggttaaaaaggtggttttggtgctgcttcttgtgacttcggtcttc
ttgtttttaaatattgcactgataaacatccatataaatgccagtatcaatggatacaga
agaaacaagacttgcagttctgattcaagtaactttacacgattttccagtcttattgta
ttaaccagcactgtgttcattttcataccctttactttgtccctggcaatgtttcttctc
ctcatcttctccatgtggaaacatcgcaagaagatgcagcacactgtcaaaatatccgga
gacgccagcaccaaagcccacagaggagttaaaagtgtgatcactttcttcctactctat
gccattttctctctgtcttttttcatatcagtttggacctctgaaaggttggaggaaaat
ctaattattctttcccaggtgatgggaatggcttatccttcatgtcactcatgtgttctg
attcttggaaacaagaagctgagacaggcctctctgtcagtgctactgtggctgaggtac
atgttcaaagatggggagccctcaggtcacaaagaatttagagaatcatcttga

KEGG   Homo sapiens (human): 54429
Entry
54429             CDS       T01001                                 

Gene name
TAS2R5, T2R5
Definition
(RefSeq) taste 2 receptor member 5
  KO
K08474  taste receptor type 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04742 Taste transduction
    54429 (TAS2R5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    54429 (TAS2R5)
G protein-coupled receptors [BR:hsa04030]
 Others
  Chemoreception
   Taste
    54429 (TAS2R5)
SSDB
Motif
Pfam: TAS2R
Other DBs
NCBI-GeneID: 54429
NCBI-ProteinID: NP_061853
OMIM: 605062
HGNC: 14912
Ensembl: ENSG00000127366
Vega: OTTHUMG00000157632
Pharos: Q9NYW4(Tbio)
UniProt: Q9NYW4 A4D1U0 Q502V5
LinkDB
Position
7q34
AA seq 299 aa
MLSAGLGLLMLVAVVEFLIGLIGNGSLVVWSFREWIRKFNWSSYNLIILGLAGCRFLLQW
LIILDLSLFPLFQSSRWLRYLSIFWVLVSQASLWFATFLSVFYCKKITTFDRPAYLWLKQ
RAYNLSLWCLLGYFIINLLLTVQIGLTFYHPPQGNSSIRYPFESWQYLYAFQLNSGSYLP
LVVFLVSSGMLIVSLYTHHKKMKVHSAGRRDVRAKAHITALKSLGCFLLLHLVYIMASPF
SITSKTYPPDLTSVFIWETLMAAYPSLHSLILIMGIPRVKQTCQKILWKTVCARRCWGP
NT seq 900 nt   +upstreamnt  +downstreamnt
atgctgagcgctggcctaggactgctgatgctggtggcagtggttgaatttctcatcggt
ttaattggaaatggaagcctggtggtctggagttttagagaatggatcagaaaattcaac
tggtcctcatataacctcattatcctgggcctggctggctgccgatttctcctgcagtgg
ctgatcattttggacttaagcttgtttccacttttccagagcagccgttggcttcgctat
cttagtatcttctgggtcctggtaagccaggccagcttatggtttgccaccttcctcagt
gtcttctattgcaagaagatcacgaccttcgatcgcccggcctacttgtggctgaagcag
agggcctataacctgagtctctggtgccttctgggctactttataatcaatttgttactt
acagtccaaattggcttaacattctatcatcctccccaaggaaacagcagcattcggtat
ccctttgaaagctggcagtacctgtatgcatttcagctcaattcaggaagttatttgcct
ttagtggtgtttcttgtttcctctgggatgctgattgtctctttgtatacacaccacaag
aagatgaaggtccattcagctggtaggagggatgtccgggccaaggctcacatcactgcg
ctgaagtccttgggctgcttcctcttacttcacctggtttatatcatggccagccccttc
tccatcacctccaagacttatcctcctgatctcaccagtgtcttcatctgggagacactc
atggcagcctatccttctcttcattctctcatattgatcatggggattcctagggtgaag
cagacttgtcagaagatcctgtggaagacagtgtgtgctcggagatgctggggcccatga

KEGG   Homo sapiens (human): 5726
Entry
5726              CDS       T01001                                 

Gene name
TAS2R38, PTC, T2R38, T2R61, THIOT
Definition
(RefSeq) taste 2 receptor member 38
  KO
K08474  taste receptor type 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04742 Taste transduction
    5726 (TAS2R38)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    5726 (TAS2R38)
G protein-coupled receptors [BR:hsa04030]
 Others
  Chemoreception
   Taste
    5726 (TAS2R38)
SSDB
Motif
Pfam: TAS2R
Other DBs
NCBI-GeneID: 5726
NCBI-ProteinID: NP_789787
OMIM: 607751
HGNC: 9584
Ensembl: ENSG00000257138
Vega: OTTHUMG00000158374
Pharos: P59533(Tbio)
UniProt: P59533
LinkDB
Position
7q34
AA seq 333 aa
MLTLTRIRTVSYEVRSTFLFISVLEFAVGFLTNAFVFLVNFWDVVKRQALSNSDCVLLCL
SISRLFLHGLLFLSAIQLTHFQKLSEPLNHSYQAIIMLWMIANQANLWLAACLSLLYCSK
LIRFSHTFLICLASWVSRKISQMLLGIILCSCICTVLCVWCFFSRPHFTVTTVLFMNNNT
RLNWQIKDLNLFYSFLFCYLWSVPPFLLFLVSSGMLTVSLGRHMRTMKVYTRNSRDPSLE
AHIKALKSLVSFFCFFVISSCAAFISVPLLILWRDKIGVMVCVGIMAACPSGHAAILISG
NAKLRRAVMTILLWAQSSLKVRADHKADSRTLC
NT seq 1002 nt   +upstreamnt  +downstreamnt
atgttgactctaactcgcatccgcactgtgtcctatgaagtcaggagtacatttctgttc
atttcagtcctggagtttgcagtggggtttctgaccaatgccttcgttttcttggtgaat
ttttgggatgtagtgaagaggcaggcactgagcaacagtgattgtgtgctgctgtgtctc
agcatcagccggcttttcctgcatggactgctgttcctgagtgctatccagcttacccac
ttccagaagttgagtgaaccactgaaccacagctaccaagccatcatcatgctatggatg
attgcaaaccaagccaacctctggcttgctgcctgcctcagcctgctttactgctccaag
ctcatccgtttctctcacaccttcctgatctgcttggcaagctgggtctccaggaagatc
tcccagatgctcctgggtattattctttgctcctgcatctgcactgtcctctgtgtttgg
tgcttttttagcagacctcacttcacagtcacaactgtgctattcatgaataacaataca
aggctcaactggcagattaaagatctcaatttattttattcctttctcttctgctatctg
tggtctgtgcctcctttcctattgtttctggtttcttctgggatgctgactgtctccctg
ggaaggcacatgaggacaatgaaggtctataccagaaactctcgtgaccccagcctggag
gcccacattaaagccctcaagtctcttgtctcctttttctgcttctttgtgatatcatcc
tgtgctgccttcatctctgtgcccctactgattctgtggcgcgacaaaataggggtgatg
gtttgtgttgggataatggcagcttgtccctctgggcatgcagccatcctgatctcaggc
aatgccaagttgaggagagctgtgatgaccattctgctctgggctcagagcagcctgaag
gtaagagccgaccacaaggcagattcccggacactgtgctga

DBGET integrated database retrieval system