KEGG   Homo sapiens (human): 2597
Entry
2597              CDS       T01001                                 

Gene name
GAPDH, G3PD, GAPD, HEL-S-162eP
Definition
(RefSeq) glyceraldehyde-3-phosphate dehydrogenase
  KO
K00134  glyceraldehyde 3-phosphate dehydrogenase [EC:1.2.1.12]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00010  Glycolysis / Gluconeogenesis
hsa01100  Metabolic pathways
hsa01200  Carbon metabolism
hsa01230  Biosynthesis of amino acids
hsa04066  HIF-1 signaling pathway
hsa05010  Alzheimer disease
hsa05130  Pathogenic Escherichia coli infection
hsa05132  Salmonella infection
Module
hsa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
hsa_M00002  Glycolysis, core module involving three-carbon compounds
hsa_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Network
nt06017  Glycogen metabolism
nt06123  TNF signaling (viruses and bacteria)
  Element
N00731  Glycolysis
N00733  LDHA deficiency in glycolysis
N00735  ENO3 deficiency in glycolysis
N00737  PGAM2 deficiency in glycolysis
N00928  Escherichia NleB to TNF-NFKB signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    2597 (GAPDH)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    2597 (GAPDH)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    2597 (GAPDH)
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    2597 (GAPDH)
   05132 Salmonella infection
    2597 (GAPDH)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    2597 (GAPDH)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    2597 (GAPDH)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.12  glyceraldehyde-3-phosphate dehydrogenase (phosphorylating)
     2597 (GAPDH)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    2597 (GAPDH)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   2597 (GAPDH)
SSDB
Motif
Pfam: Gp_dh_C Gp_dh_N DapB_N LptD_N
Other DBs
NCBI-GeneID: 2597
NCBI-ProteinID: NP_001276674
OMIM: 138400
HGNC: 4141
Ensembl: ENSG00000111640
Vega: OTTHUMG00000137379
Pharos: P04406(Tchem)
UniProt: P04406 V9HVZ4
LinkDB
Structure
PDB: 

Position
12p13.31
AA seq 335 aa
MGKVKVGVNGFGRIGRLVTRAAFNSGKVDIVAINDPFIDLNYMVYMFQYDSTHGKFHGTV
KAENGKLVINGNPITIFQERDPSKIKWGDAGAEYVVESTGVFTTMEKAGAHLQGGAKRVI
ISAPSADAPMFVMGVNHEKYDNSLKIISNASCTTNCLAPLAKVIHDNFGIVEGLMTTVHA
ITATQKTVDGPSGKLWRDGRGALQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTANV
SVVDLTCRLEKPAKYDDIKKVVKQASEGPLKGILGYTEHQVVSSDFNSDTHSSTFDAGAG
IALNDHFVKLISWYDNEFGYSNRVVDLMAHMASKE
NT seq 1008 nt   +upstreamnt  +downstreamnt
atggggaaggtgaaggtcggagtcaacggatttggtcgtattgggcgcctggtcaccagg
gctgcttttaactctggtaaagtggatattgttgccatcaatgaccccttcattgacctc
aactacatggtttacatgttccaatatgattccacccatggcaaattccatggcaccgtc
aaggctgagaacgggaagcttgtcatcaatggaaatcccatcaccatcttccaggagcga
gatccctccaaaatcaagtggggcgatgctggcgctgagtacgtcgtggagtccactggc
gtcttcaccaccatggagaaggctggggctcatttgcaggggggagccaaaagggtcatc
atctctgccccctctgctgatgcccccatgttcgtcatgggtgtgaaccatgagaagtat
gacaacagcctcaagatcatcagcaatgcctcctgcaccaccaactgcttagcacccctg
gccaaggtcatccatgacaactttggtatcgtggaaggactcatgaccacagtccatgcc
atcactgccacccagaagactgtggatggcccctccgggaaactgtggcgtgatggccgc
ggggctctccagaacatcatccctgcctctactggcgctgccaaggctgtgggcaaggtc
atccctgagctgaacgggaagctcactggcatggccttccgtgtccccactgccaacgtg
tcagtggtggacctgacctgccgtctagaaaaacctgccaaatatgatgacatcaagaag
gtggtgaagcaggcgtcggagggccccctcaagggcatcctgggctacactgagcaccag
gtggtctcctctgacttcaacagcgacacccactcctccacctttgacgctggggctggc
attgccctcaacgaccactttgtcaagctcatttcctggtatgacaacgaatttggctac
agcaacagggtggtggacctcatggcccacatggcctccaaggagtaa

DBGET integrated database retrieval system