KEGG   Homo sapiens (human): 25984Help
Entry
25984             CDS       T01001                                 

Gene name
KRT23, CK23, HAIK1, K23
Definition
(RefSeq) keratin 23
  KO
K07604  type I keratin, acidic
Organism
hsa  Homo sapiens (human)
Pathway
hsa04915  Estrogen signaling pathway
hsa05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    25984 (KRT23)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    25984 (KRT23)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    25984 (KRT23)
   04147 Exosome [BR:hsa04147]
    25984 (KRT23)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     25984 (KRT23)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   25984 (KRT23)
  Exosomal proteins of other body fluids (saliva and urine)
   25984 (KRT23)
  Exosomal proteins of colorectal cancer cells
   25984 (KRT23)
  Exosomal proteins of melanoma cells
   25984 (KRT23)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Filament CENP-F_leu_zip DUF1664 Fez1
Motif
Other DBs
NCBI-GeneID: 25984
NCBI-ProteinID: NP_056330
OMIM: 606194
HGNC: 6438
Ensembl: ENSG00000108244
Vega: OTTHUMG00000133376
Pharos: Q9C075(Tbio)
UniProt: Q9C075 A0A024R1X9 Q8TC04
LinkDB All DBs
Position
17q21.2
AA seq 422 aa AA seqDB search
MNSGHSFSQTPSASFHGAGGGWGRPRSFPRAPTVHGGAGGARISLSFTTRSCPPPGGSWG
SGRSSPLLGGNGKATMQNLNDRLASYLEKVRALEEANMKLESRILKWHQQRDPGSKKDYS
QYEENITHLQEQIVDGKMTNAQIILLIDNARMAVDDFNLKYENEHSFKKDLEIEVEGLRR
TLDNLTIVTTDLEQEVEGMRKELILMKKHHEQEMEKHHVPSDFNVNVKVDTGPREDLIKV
LEDMRQEYELIIKKKHRDLDTWYKEQSAAMSQEAASPATVQSRQGDIHELKRTFQALEID
LQTQYSTKSALENMLSETQSRYSCKLQDMQEIISHYEEELTQLRHELERQNNEYQVLLGI
KTHLEKEITTYRRLLEGESEGTREESKSSMKVSATPKIKAITQETINGRLVLCQVNEIQK
HA
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgaactccggacacagcttcagccagaccccctcggcctccttccatggcgccggaggt
ggctggggccggcccaggagcttccccagggctcccaccgtccatggcggtgcgggggga
gcccgcatctccctgtccttcaccacgcggagctgcccaccccctggagggtcttggggt
tctggaagaagcagccccctactaggcggaaatgggaaggccaccatgcagaatctcaac
gaccgcctggcctcctacctggagaaggttcgcgccctggaggaggccaacatgaagctg
gaaagccgcatcctgaaatggcaccagcagagagatcctggcagtaagaaagattattcc
cagtatgaggaaaacatcacacacctgcaggagcagatagtggatggtaagatgaccaat
gctcagattattcttctcattgacaatgccaggatggcagtggatgacttcaacctcaag
tatgaaaatgaacactcctttaagaaagacttggaaattgaagtcgagggcctccgaagg
accttagacaacctgaccattgtcacaacagacctagaacaggaggtggaaggaatgagg
aaagagctcattctcatgaagaagcaccatgagcaggaaatggagaagcatcatgtgcca
agtgacttcaatgtcaatgtgaaggtggatacaggtcccagggaagatctgattaaggtc
ctggaggatatgagacaagaatatgagcttataataaagaagaagcatcgagacttggac
acttggtataaagaacagtctgcagccatgtcccaggaggcagccagtccagccactgtg
cagagcagacaaggtgacatccacgaactgaagcgcacattccaggccctggagattgac
ctgcagacacagtacagcacgaaatctgctttggaaaacatgttatccgagacccagtct
cggtactcctgcaagctccaggacatgcaagagatcatctcccactatgaggaggaactg
acgcagctacgccatgaactggagcggcagaacaatgaataccaagtgctgctgggcatc
aaaacccacctggagaaggaaatcaccacgtaccgacggctcctggagggagagagtgaa
gggacacgggaagaatcaaagtcgagcatgaaagtgtctgcaactccaaagatcaaggcc
ataacccaggagaccatcaacggaagattagttctttgtcaagtgaatgaaatccaaaag
cacgcatga

DBGET integrated database retrieval system