KEGG   Homo sapiens (human): 260425Help
Entry
260425            CDS       T01001                                 

Gene name
MAGI3, MAGI-3, dJ730K3.2
Definition
(RefSeq) membrane associated guanylate kinase, WW and PDZ domain containing 3
  KO
K06112  membrane-associated guanylate kinase-related
Organism
hsa  Homo sapiens (human)
Pathway
hsa04015  Rap1 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    260425 (MAGI3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PDZ PDZ_6 PDZ_2 WW Guanylate_kin Tricorn_PDZ MAGI_u1
Motif
Other DBs
NCBI-GeneID: 260425
NCBI-ProteinID: NP_001136254
OMIM: 615943
HGNC: 29647
Ensembl: ENSG00000081026
Vega: OTTHUMG00000011737
Pharos: Q5TCQ9(Tbio)
UniProt: Q5TCQ9
LinkDB All DBs
Structure
PDB: 

Position
1p13.2
AA seq 1481 aa AA seqDB search
MSKTLKKKKHWLSKVQECAVSWAGPPGDFGAEIRGGAERGEFPYLGRLREEPGGGTCCVV
SGKAPSPGDVLLEVNGTPVSGLTNRDTLAVIRHFREPIRLKTVKPGKVINKDLRHYLSLQ
FQKGSIDHKLQQVIRDNLYLRTIPCTTRAPRDGEVPGVDYNFISVEQFKALEESGALLES
GTYDGNFYGTPKPPAEPSPFQPDPVDQVLFDNEFDAESQRKRTTSVSKMERMDSSLPEEE
EDEDKEAINGSGNAENRERHSESSDWMKTVPSYNQTNSSMDFRNYMMRDETLEPLPKNWE
MAYTDTGMIYFIDHNTKTTTWLDPRLCKKAKAPEDCEDGELPYGWEKIEDPQYGTYYVDH
LNQKTQFENPVEEAKRKKQLGQVEIGSSKPDMEKSHFTRDPSQLKGVLVRASLKKSTMGF
GFTIIGGDRPDEFLQVKNVLKDGPAAQDGKIAPGDVIVDINGNCVLGHTHADVVQMFQLV
PVNQYVNLTLCRGYPLPDDSEDPVVDIVAATPVINGQSLTKGETCMNPQDFKPGAMVLEQ
NGKSGHTLTGDGLNGPSDASEQRVSMASSGSSQPELVTIPLIKGPKGFGFAIADSPTGQK
VKMILDSQWCQGLQKGDIIKEIYHQNVQNLTHLQVVEVLKQFPVGADVPLLILRGGPPSP
TKTAKMKTDKKENAGSLEAINEPIPQPMPFPPSIIRSGSPKLDPSEVYLKSKTLYEDKPP
NTKDLDVFLRKQESGFGFRVLGGDGPDQSIYIGAIIPLGAAEKDGRLRAADELMCIDGIP
VKGKSHKQVLDLMTTAARNGHVLLTVRRKIFYGEKQPEDDSSQAFISTQNGSPRLNRAEV
PARPAPQEPYDVVLQRKENEGFGFVILTSKNKPPPGVIPHKIGRVIEGSPADRCGKLKVG
DHISAVNGQSIVELSHDNIVQLIKDAGVTVTLTVIAEEEHHGPPSGTNSARQSPALQHRP
MGQSQANHIPGDRSALEGEIGKDVSTSYRHSWSDHKHLAQPDTAVISVVGSRHNQNLGCY
PVELERGPRGFGFSLRGGKEYNMGLFILRLAEDGPAIKDGRIHVGDQIVEINGEPTQGIT
HTRAIELIQAGGNKVLLLLRPGTGLIPDHGDWDINNPSSSNVIYDEQSPLPPSSHFASIF
EESHVPVIEESLRVQICEKAEELKDIVPEKKSTLNENQPEIKHQSLLQKNVSKRDPPSSH
GHSNKKNLLKVENGVTRRGRSVSPKKPASQHSEEHLDKIPSPLKNNPKRRPRDQSLSPSK
GENKSCQVSTRAGSGQDQCRKSRGRSASPKKQQKIEGSKAPSNAEAKLLEGKSRRIAGYT
GSNAEQIPDGKEKSDVIRKDAKQNQLEKSRTRSPEKKIKRMVEKSLPSKMTNKTTSKEVS
ENEKGKKVTTGETSSSNDKIGENVQLSEKRLKQEPEEKVVSNKTEDHKGKELEAADKNKE
TGRFKPESSSPVKKTLITPGPWKVPSGNKVTGTIGMAEKRQ
NT seq 4446 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaagacgctgaagaagaagaagcactggctcagcaaggtgcaggagtgcgccgtg
tcctgggccgggcccccgggcgacttcggcgcggagatccgcggtggcgcggagcgtggc
gagttcccctacctggggcggctccgcgaggagcccggcgggggcacctgctgcgtcgtc
tcgggcaaggcgcccagcccaggcgatgtgctgctggaggtaaacgggacgcctgtcagc
gggctcaccaaccgggacaccctggctgtcatccgccacttccgcgagcccatccgtctc
aagactgtgaaaccaggcaaagtcattaataaagatttgcggcattacctaagtcttcag
tttcaaaaaggatcaattgaccacaaactgcagcaagtgatcagagataatctctacttg
agaaccattccatgcactacaagggcccccagggatggagaagtaccaggagtggattat
aatttcatttccgttgaacagttcaaagcactggaagagagtggagcattgttagaaagt
gggacatatgatggaaacttctatggaactcccaagcctccagcagaacccagccctttt
cagccagatccagttgatcaagtcctctttgataatgagtttgatgcagaatctcaaaga
aaacgaacgacatctgtcagcaagatggaaagaatggatagctctcttcctgaagaggaa
gaagatgaggacaaggaagctattaatggcagtggaaacgcagaaaacagagagaggcat
tctgagtcatctgactggatgaagactgttccaagttacaaccaaacaaatagctccatg
gactttagaaattatatgatgagagatgagactctggaaccactgcccaaaaactgggaa
atggcctacactgacacagggatgatctacttcattgaccacaataccaagacaaccacc
tggttggatcctcgtctttgtaagaaagccaaagcccctgaagactgtgaagatggagag
cttccttatggctgggagaaaatagaggaccctcagtatgggacatactatgttgatcac
cttaaccagaaaacccagtttgaaaatccagtggaggaagccaaaaggaaaaagcagtta
ggacaggttgaaattgggtcttcaaaaccagatatggaaaaatcacacttcacaagagat
ccatcccagcttaaaggtgtccttgttcgagcatcactgaaaaaaagcacaatgggattt
ggttttactattattggtggagatagacctgatgagttcctacaagtgaaaaatgtgctg
aaagatggtcccgcagctcaggatgggaaaattgcaccaggcgatgttattgtagacatc
aatggcaactgtgtcctcggtcacactcatgcagatgttgtccagatgtttcaattggta
cctgtcaatcagtatgtaaacctcactttatgtcgtggttatccacttcctgatgacagt
gaagatcctgttgtggacattgttgctgctacccctgtcatcaatggacagtcattaacc
aagggagagacttgcatgaatcctcaggattttaagccaggagcaatggttctggagcag
aatggaaaatcgggacacactttgactggtgatggtctcaatggaccatcagatgcaagt
gagcagagagtatccatggcatcgtcaggcagctcccagcctgaactagtgactatccct
ttgattaagggccctaaagggtttgggtttgcaattgctgacagccctactggacagaag
gtgaaaatgatactggatagtcagtggtgtcaaggccttcagaaaggagatataattaag
gaaatataccatcaaaatgtgcagaatttaacacatctccaagtggtagaggtgctaaag
cagtttccagtaggtgctgatgtaccattgcttatcttaagaggaggtcctccttcacca
accaaaactgccaaaatgaaaacagataaaaaggaaaatgcaggaagtttggaggccata
aatgagcctattcctcagcctatgccttttccaccgagcattatcaggtcaggatcccca
aaattggatccttctgaggtctacctgaaatctaagactttatatgaagataaaccacca
aacaccaaagatttggatgtttttcttcgaaaacaagagtcagggtttggcttcagggtg
ctaggaggagatggacctgaccagtctatatatattggggctattattcccctgggagca
gctgagaaagatggtcggctccgcgcagctgatgaactaatgtgcattgatggaattcct
gttaaagggaaatcacacaaacaagtcttggacctcatgacaactgctgctcgaaatggc
catgtgttactaactgtcagacggaagatcttctatggagaaaaacaacccgaggacgac
agctctcaggccttcatttcaacacagaatggatctccccgcctgaaccgggcagaggtc
ccagccaggcctgcaccccaggagccctatgatgttgtcttgcaacgaaaagaaaatgaa
ggatttggctttgtcatcctcacctccaaaaacaaaccacctccaggagttattcctcat
aaaattggccgagtcatagaaggaagtccggctgaccgctgtggaaaactgaaagttgga
gatcatatctctgcagtgaatgggcagtccattgttgaactgtctcatgataacattgtt
cagctgatcaaagatgctggtgtcaccgtcacactaacggtcattgctgaagaagagcat
catggtccaccatcaggaacaaactcagccaggcaaagcccagccctgcagcacaggccc
atgggacagtcacaggccaaccacatacctggggacagaagtgccctagaaggtgaaatt
ggaaaagatgtctccacttcttacagacattcttggtcagaccacaagcaccttgcacag
cctgacaccgcagtaatttcagttgtaggcagtcggcacaatcagaaccttggttgttat
ccagtagagctggagagaggcccccggggctttggattcagcctccgaggggggaaggag
tacaacatggggctgttcatccttcgtcttgctgaagatggtcctgccatcaaagatggc
agaattcatgttggtgaccagattgttgaaatcaatggggaacctacacaaggaatcaca
catactcgagcaattgagctcattcaggctggtggaaataaagttcttcttcttttgagg
ccaggaactggcttgatacctgaccatggtgattgggatattaataatccttcgtcttca
aatgtgatttatgatgaacagtcaccattacccccatcttcacattttgcttccatattt
gaagagtctcacgtgccagtaattgaagaatctttgagagttcagatatgtgaaaaggca
gaagaattaaaggacattgtgcctgaaaagaaaagcactttaaatgaaaatcagcctgag
ataaagcatcagtctcttctccagaaaaatgtgagtaagagggatccacccagcagtcat
gggcacagtaacaagaaaaatctattaaaagtagaaaatggtgttacacgaagaggtaga
tcggttagtcccaaaaagccagccagtcaacattcagaggaacatttggataagattcct
agtcctctaaaaaataaccccaaaagaagacccagagatcaatccctcagccccagcaaa
ggggaaaataaaagttgtcaggtcagcaccagggcaggctctggacaagatcagtgcaga
aaaagcagaggtcggtcggccagcccaaaaaagcagcaaaaaattgaaggaagcaaagct
ccatcaaatgctgaggccaaattattagagggtaagagtcgaagaatagcaggctatacg
ggcagtaatgctgagcagatcccagatgggaaggaaaaatcagacgtcatcaggaaagat
gcaaagcagaatcagttggaaaaaagcagaacaaggtctccagagaaaaaaatcaaaaga
atggttgagaaatctcttccatccaaaatgactaataagactacaagtaaagaagtatct
gaaaatgaaaaaggaaagaaagtaaccacaggagaaacaagttctagtaacgataaaata
ggagaaaatgtccagctatcagaaaagaggctgaagcaagaacctgaagagaaggtagtt
tcaaacaaaacagaagatcacaaagggaaagaactagaggcagctgacaaaaacaaagag
actggaaggttcaaaccggaaagcagttctccagttaagaaaacactgataactccaggg
ccctggaaggttccaagtggaaataaagtcacaggcactattggtatggctgagaaacgg
cagtaa

KEGG   Homo sapiens (human): 9223Help
Entry
9223              CDS       T01001                                 

Gene name
MAGI1, AIP-3, AIP3, BAIAP1, BAP-1, BAP1, MAGI-1, MAGI-1b, Magi1d, TNRC19, WWP3
Definition
(RefSeq) membrane associated guanylate kinase, WW and PDZ domain containing 1
  KO
K05631  atrophin-1 interacting protein 3 (BAI1-associated protein 1)
Organism
hsa  Homo sapiens (human)
Pathway
hsa04015  Rap1 signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04530  Tight junction
hsa05165  Human papillomavirus infection
Network
nt06135  Cytoskeletal regulation (virus)
nt06166  Human papillomavirus (HPV)
  Element
N00342  MAGI-PTEN signaling pathway
N00343  HPV E6 to MAGI-PTEN signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    9223 (MAGI1)
   04151 PI3K-Akt signaling pathway
    9223 (MAGI1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    9223 (MAGI1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    9223 (MAGI1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PDZ PDZ_6 MAGI_u5 PDZ_2 MAGI_u1 WW Guanylate_kin Tricorn_PDZ Peptidase_C58 Serglycin
Motif
Other DBs
NCBI-GeneID: 9223
NCBI-ProteinID: NP_001028229
OMIM: 602625
HGNC: 946
Ensembl: ENSG00000151276
Vega: OTTHUMG00000157554
Pharos: Q96QZ7(Tbio)
UniProt: Q96QZ7
LinkDB All DBs
Structure
PDB: 

Position
3p14.1
AA seq 1462 aa AA seqDB search
MSKVIQKKNHWTSRVHECTVKRGPQGELGVTVLGGAEHGEFPYVGAVAAVEAAGLPGGGE
GPRLGEGELLLEVQGVRVSGLPRYDVLGVIDSCKEAVTFKAVRQGGRLNKDLRHFLNQRF
QKGSPDHELQQTIRDNLYRHAVPCTTRSPREGEVPGVDYNFLTVKEFLDLEQSGTLLEVG
TYEGNYYGTPKPPSQPVSGKVITTDALHSLQSGSKQSTPKRTKSYNDMQNAGIVHAENEE
EDDVPEMNSSFTADSGEQEEHTLQETALPPVNSSIIAAPITDPSQKFPQYLPLSAEDNLG
PLPENWEMAYTENGEVYFIDHNTKTTSWLDPRCLNKQQKPLEECEDDEGVHTEELDSELE
LPAGWEKIEDPVYGIYYVDHINRKTQYENPVLEAKRKKQLEQQQQQQQQQQQQQQQQQQQ
QTEEWTEDHSALVPPVIPNHPPSNPEPAREVPLQGKPFFTRNPSELKGKFIHTKLRKSSR
GFGFTVVGGDEPDEFLQIKSLVLDGPAALDGKMETGDVIVSVNDTCVLGHTHAQVVKIFQ
SIPIGASVDLELCRGYPLPFDPDDPNTSLVTSVAILDKEPIIVNGQETYDSPASHSSKTG
KVNGMKDARPSSPADVASNSSHGYPNDTVSLASSIATQPELITVHIVKGPMGFGFTIADS
PGGGGQRVKQIVDSPRCRGLKEGDLIVEVNKKNVQALTHNQVVDMLVECPKGSEVTLLVQ
RGGLPVPKKSPKSQPLERKDSQNSSQHSVSSHRSLHTASPSHSTQVLPEFPPAEAQAPDQ
TDSSGQKKPDPFKIWAQSRSMYENRLPDYQEQDIFLWRKETGFGFRILGGNEPGEPIYIG
HIVPLGAADTDGRLRSGDELICVDGTPVIGKSHQLVVQLMQQAAKQGHVNLTVRRKVVFA
VPKTENEVPSPASSHHSSNQPASLTEEKRTPQGSQNSLNTVSSGSGSTSGIGSGGGGGSG
VVSTVVQPYDVEIRRGENEGFGFVIVSSVSRPEAGTTFGNACVAMPHKIGRIIEGSPADR
CGKLKVGDRILAVNGCSITNKSHSDIVNLIKEAGNTVTLRIIPGDESSNATLLTNAEKIA
TITTTHTPSQQGTQETRNTTKPKQESQFEFKAPQATQEQDFYTVELERGAKGFGFSLRGG
REYNMDLYVLRLAEDGPAERCGKMRIGDEILEINGETTKNMKHSRAIELIKNGGRRVRLF
LKRGDGSVPEYDPSSDRHGPATGPQGVPEVRAGPDRRQHPSLESSYPPDLHKSSPHGEKR
AHARDPKGSREYSRQPNEHHTWNGTSRKPDSGACRPKDRAPEGRRDAQAERAAAANGPKR
RSPEKRREGTRSADNTLERREKHEKRRDVSPERRRERSPTRRRDGSPSRRRRSLERLLEQ
RRSPERRRGGSPERRAKSTDRRRARSPERRRERSLDKRNREDRASHREREEANLKQDAGR
SSRHPPEQRRRPYKECSTDLSI
NT seq 4389 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaagtgatccagaagaagaaccactggactagcagggttcacgaatgcaccgtg
aagcggggaccccagggcgagctgggggtgacggtgctgggaggcgcggagcacggggag
tttccgtacgtcggagcggtggcggcggtcgaggcagcggggcttcccggcggcggcgag
ggcccgaggctgggcgaaggggagctgcttctggaggtgcagggggtccgggtgtccggc
ttgccccgctatgacgtgctgggggtcatcgacagctgcaaggaggccgtcaccttcaag
gccgtcagacaaggaggaaggctgaacaaggacctgcgacattttctcaatcagcgattc
cagaaggggtctcctgatcatgagctccagcagaccataagggataacctttaccgccat
gctgtgccttgcacaacccgatctcccagagaaggagaagtgcctggcgtggactataac
tttctgactgtgaaggagttcttggacctcgagcagagtgggactcttctggaagtcggc
acctatgaaggaaactattatgggacacccaagcctcctagccagccagtcagtgggaaa
gtgatcacgacggatgccttgcacagccttcagtctggctctaagcagtcgaccccgaag
cgaaccaagtcctacaatgatatgcaaaatgctggcatagtccacgcggagaatgaggag
gaggatgacgttcctgaaatgaacagcagctttacagccgattctggtgaacaagaggag
cacactctccaagaaacagcattaccacctgtgaatagtagcatcatcgctgctcccatc
acggacccttctcagaagttccctcaatacctacctctttctgcagaggataatttaggt
cctctacctgaaaactgggagatggcctatactgaaaatggagaagtctattttatagac
cataacacgaaaacaacatcttggttagaccctcggtgcctaaacaagcagcagaagcca
ctggaagagtgtgaagatgatgaaggggtacacaccgaggagctggacagtgaactagaa
ctgcctgctggttgggaaaagattgaagaccctgtctatggtatctactatgtagaccac
atcaacaggaagacacaatatgagaacccggttctagaagccaaacggaagaagcagctt
gagcagcagcagcagcagcaacagcagcagcaacagcagcagcagcagcagcagcagcag
cagacagaagaatggacagaagatcactcagcccttgtgcctcctgttattccaaaccac
cctccaagcaatccagagccagccagagaagttccacttcagggcaaacccttttttaca
cgaaacccttctgagttgaaaggcaagttcattcacacaaagctgcggaaaagcagtcgt
ggctttggcttcacggtggttggaggggatgaacctgatgagtttctccagatcaagagc
ttggtcctagatggtcctgctgcattggatggcaagatggaaacaggggatgtgattgta
agtgtgaatgacacctgtgttttgggacacacacatgctcaagttgtgaagatcttccag
tccatccccattggtgccagcgtggaccttgaactctgccgaggttatccattgcctttt
gatccagatgaccccaatacaagtttagtgacctcggtagccattttggataaagaacca
attattgtgaatgggcaagagacctatgattcaccagctagccacagtagtaaaacaggc
aaagtcaatggcatgaaggatgccaggccaagcagcccagcggacgtggcttcaaatagt
tctcatggttatcctaatgacactgtttctttggcttcctccatagccactcagccagaa
ctcataactgttcatattgtcaaagggccaatgggctttggttttactatcgcagacagt
cctggtgggggtggccaaagagtgaaacagattgttgacagcccaaggtgccgaggcctg
aaagaaggggatctcatagtggaagttaataagaagaacgtgcaggccctaactcacaac
caagtggtggatatgctggttgagtgtcctaagggaagtgaggtcacattgttggtgcaa
cgaggagggctgccagttcccaagaagagcccaaagtcgcaaccactggaaaggaaagac
agccagaatagttctcagcacagtgtttccagccaccgaagcctgcacacagcatcccca
agccacagcacacaggtgctccccgagttcccacctgcagaggcccaagctccagatcaa
actgacagctctggccagaaaaaaccagatccttttaaaatctgggcccagtccaggagc
atgtatgaaaaccgacttccagattaccaggaacaggacatcttcctctggagaaaagag
actggatttggatttaggattctgggtggaaatgaaccaggggaacctatttatattggt
cacatcgtaccactgggtgctgctgatactgacggccgcctgaggtctggagatgaatta
atctgtgtggatgggacgccagtaattggaaaatcacaccagcttgtggtccagcttatg
caacaagctgccaagcaaggccacgtcaatctcacggtgcggcgtaaagtggtttttgcg
gtgcccaaaaccgagaacgaggtgccctcgccagcctcctctcatcacagtagcaaccag
ccggcctcgctgacagaagagaagcgcactccgcagggcagccagaactcgctgaacacg
gtgagctcgggcagcggcagcaccagcggcatcggcagtggcggcggcgggggcagcggc
gtggtcagcaccgtggtgcagccctacgacgtggagatccggcgcggggagaacgagggc
ttcggcttcgtcatcgtgtcctcggtgagcaggcccgaagcaggcacgacctttggcaat
gcatgtgtggctatgcctcacaaaataggtcggattattgaggggagccctgctgaccgc
tgtggcaagctgaaagtaggagaccggatcttggcagtaaatggatgttccatcaccaac
aaatcccattcagacattgtgaacctaatcaaggaagcgggaaacacagttaccctccgc
atcattcctggggatgagtcctcgaatgccaccttgctgaccaatgcagagaagattgcc
accatcaccaccacacacaccccttctcagcaagggacccaggagacaaggaataccacc
aaaccaaagcaggaatctcaatttgagttcaaagcaccccaagcaacacaggagcaagat
ttttacactgtggaactggaaagaggagccaagggatttggctttagccttcgaggaggc
cgagagtataacatggacctctatgttctgcgcttagcagaggacggtcctgcggagagg
tgtggaaagatgaggattggtgatgaaattttagagatcaatggtgagaccaccaaaaac
atgaagcattctcgagctatagaactgattaagaatggtggccgcagagttcgtctgttt
ctgaagcggggagacggctcagtaccagaatatgaccccagcagcgaccgccacggcccc
gccaccggtccacaaggtgttccggaagtgagggccgggcccgaccgccggcagcatccg
tcattggagtccagttacccacccgatcttcacaaatcatcaccacatggggaaaagcgg
gcacacgcaagggatccgaaaggcagcagagagtatagcagacaacccaatgaacaccac
acctggaatgggacttcgaggaaacccgacagcggggcatgccgacccaaggaccgggcg
ccggagggacggagggacgcgcaggccgagcgcgcggcagccgccaacggccccaagagg
cggtccccagagaagcggagggagggcacccgcagcgccgacaacactttggagaggagg
gagaagcacgagaagagacgagacgtctctccggagcggaggcgagagcggtcacccacc
cgcaggagagacggctcccccagccggcggagacggtctctggagagactcctggagcag
aggaggtcccccgagcgcaggagagggggctcgcccgagcgcagggccaagtccaccgac
cggaggcgcgcacgctcccccgagcgcaggagagagcggtccctggacaaaaggaacaga
gaggacagagccagccaccgagaaagggaagaggcgaatctgaaacaggatgccggcaga
agttccagacatcccccggagcagagaaggcgaccttacaaagaatgtagcaccgacctc
agtatctga

KEGG   Homo sapiens (human): 9863Help
Entry
9863              CDS       T01001                                 

Gene name
MAGI2, ACVRIP1, AIP-1, AIP1, ARIP1, MAGI-2, NPHS15, SSCAM
Definition
(RefSeq) membrane associated guanylate kinase, WW and PDZ domain containing 2
  KO
K05629  atrophin-1 interacting protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04015  Rap1 signaling pathway
hsa04151  PI3K-Akt signaling pathway
Network
nt06135  Cytoskeletal regulation (virus)
nt06166  Human papillomavirus (HPV)
  Element
N00342  MAGI-PTEN signaling pathway
Disease
H01657  Nephrotic syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    9863 (MAGI2)
   04151 PI3K-Akt signaling pathway
    9863 (MAGI2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PDZ PDZ_6 MAGI_u1 PDZ_2 WW Guanylate_kin MAGI_u5
Motif
Other DBs
NCBI-GeneID: 9863
NCBI-ProteinID: NP_036433
OMIM: 606382
HGNC: 18957
Ensembl: ENSG00000187391
Vega: OTTHUMG00000130697
Pharos: Q86UL8(Tbio)
UniProt: Q86UL8
LinkDB All DBs
Structure
PDB: 

Position
7q21.11
AA seq 1455 aa AA seqDB search
MSKSLKKKSHWTSKVHESVIGRNPEGQLGFELKGGAENGQFPYLGEVKPGKVAYESGSKL
VSEELLLEVNETPVAGLTIRDVLAVIKHCKDPLRLKCVKQGGIVDKDLRHYLNLRFQKGS
VDHELQQIIRDNLYLRTVPCTTRPHKEGEVPGVDYIFITVEDFMELEKSGALLESGTYED
NYYGTPKPPAEPAPLLLNVTDQILPGATPSAEGKRKRNKSVSNMEKASIEPPEEEEEERP
VVNGNGVVVTPESSEHEDKSAGASGEMPSQPYPAPVYSQPEELKEQMDDTKPTKPEDNEE
PDPLPDNWEMAYTEKGEVYFIDHNTKTTSWLDPRLAKKAKPPEECKENELPYGWEKIDDP
IYGTYYVDHINRRTQFENPVLEAKRKLQQHNMPHTELGTKPLQAPGFREKPLFTRDASQL
KGTFLSTTLKKSNMGFGFTIIGGDEPDEFLQVKSVIPDGPAAQDGKMETGDVIVYINEVC
VLGHTHADVVKLFQSVPIGQSVNLVLCRGYPLPFDPEDPANSMVPPLAIMERPPPVMVNG
RHNYETYLEYISRTSQSVPDITDRPPHSLHSMPTDGQLDGTYPPPVHDDNVSMASSGATQ
AELMTLTIVKGAQGFGFTIADSPTGQRVKQILDIQGCPGLCEGDLIVEINQQNVQNLSHT
EVVDILKDCPIGSETSLIIHRGGFFSPWKTPKPIMDRWENQGSPQTSLSAPAIPQNLPFP
PALHRSSFPDSTEAFDPRKPDPYELYEKSRAIYESRQQVPPRTSFRMDSSGPDYKELDVH
LRRMESGFGFRILGGDEPGQPILIGAVIAMGSADRDGRLHPGDELVYVDGIPVAGKTHRY
VIDLMHHAARNGQVNLTVRRKVLCGGEPCPENGRSPGSVSTHHSSPRSDYATYTNSNHAA
PSSNASPPEGFASHSLQTSDVVIHRKENEGFGFVIISSLNRPESGSTITVPHKIGRIIDG
SPADRCAKLKVGDRILAVNGQSIINMPHADIVKLIKDAGLSVTLRIIPQEELNSPTSAPS
SEKQSPMAQQSPLAQQSPLAQPSPATPNSPIAQPAPPQPLQLQGHENSYRSEVKARQDVK
PDIRQPPFTDYRQPPLDYRQPPGGDYQQPPPLDYRQPPLLDYRQHSPDTRQYPLSDYRQP
QDFDYFTVDMEKGAKGFGFSIRGGREYKMDLYVLRLAEDGPAIRNGRMRVGDQIIEINGE
STRDMTHARAIELIKSGGRRVRLLLKRGTGQVPEYDEPAPWSSPAAAAPGLPEVGVSLDD
GLAPFSPSHPAPPSDPSHQISPGPTWDIKREHDVRKPKELSACGQKKQRLGEQRERSASP
QRAARPRLEEAPGGQGRPEAGRPASEARAPGLAAADAADAARAGGKEAPRAAAGSELCRR
EGPGAAPAFAGPGGGGSGALEAEGRAGARAGPRPGPRPPGGAPARKAAVAPGPWKVPGSD
KLPSVLKPGASAASR
NT seq 4368 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaaagcttgaaaaagaaaagccactggactagcaaagtccatgagagtgtcatt
ggcaggaacccggagggccagctgggctttgaactgaaggggggcgccgagaatggacag
ttcccctacctgggggaggtgaagcccggcaaggtggcctatgagagcggcagcaaattg
gtgtcggaggagctgctgctggaggtgaacgagacccccgtggcggggctcaccatcagg
gacgtgctggccgtgatcaaacactgcaaggaccccctccggctcaagtgtgtcaagcaa
ggaggaattgttgataaagaccttcgtcactacctcaacttacgatttcaaaagggttct
gtggaccatgagcttcagcaaatcattcgtgacaacctctacctccgcacggtgccatgc
accacaaggccacataaggagggtgaggtccctggagtggattatattttcatcactgtt
gaagattttatggaattggagaaaagtggtgctctcctagaaagtgggacttatgaagac
aattactacggtaccccaaagccgccagcagaaccagcaccattattgttaaatgtaaca
gaccagatacttccaggagccactccaagtgctgaaggaaaacggaagaggaataaatca
gtgagcaacatggagaaagccagtatagagcctcctgaggaggaagaggaagagaggcct
gtggtcaatggaaatggagtagtagtaacaccagaatccagtgaacatgaagacaaaagt
gcaggtgcctcaggggagatgccctcccagccttatcctgcaccagtgtacagtcagcct
gaggagctgaaggagcagatggatgacacaaagccaactaaacctgaagacaatgaggaa
ccagacccattgcctgataactgggaaatggcctatacagagaagggcgaagtctacttc
attgaccataacacaaagacaacatcatggctggatccacgacttgcgaaaaaggctaaa
cctccagaagagtgcaaagaaaatgagcttccatatggctgggaaaaaatcgatgatccc
atttatggcacttattatgttgaccacataaatagaagaacacagtttgaaaatcctgtc
ctggaagcaaaaaggaagctacagcaacataacatgccccacacagaacttggaacaaag
cccctgcaggccccaggtttccgagaaaaaccactcttcacccgggatgcatcccagttg
aagggaacattcctcagcaccaccctaaaaaagagcaacatgggctttggatttaccatc
attggtggagacgagcctgatgagtttctgcaggtgaaaagtgtgattccggatgggcct
gcagcacaggatggaaaaatggaaacaggtgatgtcattgtctatattaatgaagtttgt
gtccttggacacactcatgcagatgttgtcaaacttttccagtctgttcctattggtcag
agtgtcaacctggtgttgtgtcgtggctaccctttgccctttgatcctgaagaccctgct
aacagcatggtgccaccccttgcaataatggagaggccacctccagtgatggtcaatgga
agacacaactatgaaacatatttggagtacatttctcggacctcacagtcagttccagat
ataacagatcggccgcctcattctctgcactccatgccaactgatggtcagctagacggc
acgtatccaccgcccgtccatgatgacaatgtgtctatggcttcatctggggccacccaa
gctgaacttatgaccttaaccattgtgaaaggtgcccagggcttcggcttcactattgcc
gacagtcctacaggacagcgggtgaaacaaatacttgacattcagggatgccctggcctg
tgtgaaggcgacctcattgttgagatcaaccagcagaatgtacagaacctgagccataca
gaagtagtggatatacttaaggactgtcccattggaagtgaaacttctttgattatccat
cgaggaggtttcttttctccatggaaaactccaaagcctataatggaccgatgggagaat
caaggcagtcctcaaacgagtttatctgctccggccataccgcagaacctgcccttccca
cctgcccttcacaggagctcctttcctgactcaacagaggcctttgacccacggaagcct
gatccatatgagctctacgagaaatctagggccatttatgaaagtaggcaacaagtgcca
cccaggaccagttttcgaatggattcctctggtccagattataaggaattggatgttcat
cttcggaggatggagtctggatttggcttcagaatcctcgggggagatgagcctggacag
cctattttgattggagctgtcattgccatgggctcagccgacagagatggccgccttcac
ccaggagatgagcttgtgtatgttgatgggattccagtagccggcaaaacccaccgctat
gtcatcgacctcatgcaccacgcagcccgcaatgggcaggtcaacctcactgtgagaaga
aaggtgctatgtggaggggagccctgcccagagaacgggagaagtccaggctctgtatcc
acccaccacagctctccacgcagtgactacgcaacctacaccaacagcaaccacgctgcc
cccagtagcaatgcctctccccctgaaggcttcgcctcccacagcctgcagaccagtgat
gtggtcattcaccgcaaagagaatgagggcttcggctttgtcatcatcagctccctgaac
aggcctgagtctggatccactataactgtgccccataaaatcggacgcatcattgatggg
agtcctgcagatcgctgtgcaaaactaaaagtgggagaccggatcctagcagtgaatggc
cagtctatcatcaacatgcctcacgctgacatcgtgaagctcatcaaggatgcaggtctt
agtgtcacccttcgcatcattcctcaggaggagctcaacagccccacctcggcacccagc
tcagagaagcagagtcccatggcgcagcagagtcccctggcacagcagagtcccctggcc
cagccaagcccagccacccccaacagccccatcgcccagccagcaccacctcaaccactt
cagctgcaaggacacgaaaatagttacaggtcggaagtgaaagcaaggcaagatgtgaaa
ccagacatccgacagcctccattcacagactacaggcagcccccgctggattacaggcaa
cccccaggaggggactaccagcagcccccacccttggactacaggcagcctcccctactg
gactacaggcagcactcccccgacaccaggcagtaccctctgtcggactacagacaaccc
caggattttgattatttcactgtggacatggagaaaggagccaaaggatttggattcagc
attcgtggaggaagggaatacaaaatggatttgtatgtgttgagactggcagaagatgga
ccagcaataaggaatgggaggatgagggtaggagatcaaatcattgaaatcaatggggaa
agcacaagggacatgacacatgccagagcaatagaactcatcaaatctggaggaagacga
gtgaggctgctgctcaagagaggcacgggacaggtcccagaatatgacgaacccgccccc
tggagttctcccgctgccgccgccccaggtctgccggaagtaggcgtctccctggacgac
ggcctcgctccattctctccatcacatccagccccaccctccgacccttcccaccagata
agcccaggcccaacttgggatatcaaacgggaacacgacgttaggaaaccaaaggagctt
tcagcctgcggccagaagaagcagcgcctcggggagcagagggagcgctcggcgagtccg
cagagggccgcgcggccgaggctcgaggaggcgcccggcggccaggggcggcccgaggcc
ggcaggcccgcctcggaggccagggcgcccgggctcgcggcggcagacgcggcggacgcg
gcgcgggcgggcgggaaggaggcgccccgtgcggcggcgggctccgagctctgccggcgc
gaaggcccgggggctgcgccggcgtttgccggcccgggcggcggcggcagcggcgcgctg
gaggccgagggcagggcgggtgcgcgcgcgggtccccggccgggcccgcgacccccgggg
ggcgccccggcgcgcaaggccgccgtcgcgccggggccctggaaggtgccgggttctgac
aagctgcccagcgtcctcaaacccggcgcctcggccgccagcagatga

DBGET integrated database retrieval system