KEGG   Homo sapiens (human): 26063
Entry
26063             CDS       T01001                                 

Gene name
DECR2, PDCR, SDR17C1
Definition
(RefSeq) 2,4-dienoyl-CoA reductase 2
  KO
K13237  2,4-dienoyl-CoA reductase [(3E)-enoyl-CoA-producing], peroxisomal [EC:1.3.1.124]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    26063 (DECR2)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.124  2,4-dienoyl-CoA reductase [(3E)-enoyl-CoA-producing]
     26063 (DECR2)
SSDB
Motif
Pfam: adh_short_C2 adh_short KR
Other DBs
NCBI-GeneID: 26063
NCBI-ProteinID: NP_065715
OMIM: 615839
HGNC: 2754
Ensembl: ENSG00000242612
Vega: OTTHUMG00000047846
Pharos: Q9NUI1(Tbio)
UniProt: Q9NUI1
LinkDB
Structure
PDB: 
4FC7 4FC6

Position
16p13.3
AA seq 292 aa
MAQPPPDVEGDDCLPAYRHLFCPDLLRDKVAFITGGGSGIGFRIAEIFMRHGCHTVIASR
SLPRVLTAARKLAGATGRRCLPLSMDVRAPPAVMAAVDQALKEFGRIDILINCAAGNFLC
PAGALSFNAFKTVMDIDTSGTFNVSRVLYEKFFRDHGGVIVNITATLGNRGQALQVHAGS
AKAAVDAMTRHLAVEWGPQNIRVNSLAPGPISGTEGLRRLGGPQASLSTKVTASPLQRLG
NKTEIAHSVLYLASPLASYVTGAVLVADGGAWLTFPNGVKGLPDFASFSAKL
NT seq 879 nt   +upstreamnt  +downstreamnt
atggcccagccgccgcccgacgtggagggggacgactgtctccccgcgtaccgccacctc
ttctgcccggacctgctgcgggacaaagtggccttcatcacaggaggcggctctgggatt
gggttccggattgctgagattttcatgcggcacggctgccatacggtgattgccagtagg
agcctgccgcgagtgctgacggccgccaggaagctggctggggccaccggccggcgctgc
ctccctctctctatggacgtccgagcgcccccagctgtcatggccgccgtggaccaggct
ctgaaggagtttggcagaatcgacattctcattaactgtgcggccgggaacttcctgtgc
cccgctggcgccttgtccttcaacgccttcaagaccgtgatggacatcgataccagcggc
accttcaatgtgtctcgtgtgctctatgagaagttcttccgggaccacggaggggtgatc
gtgaacatcactgccaccctggggaaccgggggcaggcgctccaggtgcatgcaggctcc
gccaaggccgctgtggacgcgatgacgcggcacttggctgtggagtggggtccccaaaac
atccgcgtcaacagcctcgcccctggccccatcagtggcacagaggggctccggcgactg
ggtggccctcaggccagcctgagcaccaaggtcactgccagcccgctgcagaggctgggg
aacaagaccgagatcgcccacagcgtgctctacctggccagccctctggcttcctacgtg
acgggggccgtgctggtggccgatggcggggcatggttgacgttcccaaacggtgtcaaa
gggctgccggatttcgcatccttctctgctaagctctag

DBGET integrated database retrieval system