KEGG   Homo sapiens (human): 26086Help
Entry
26086             CDS       T01001                                 

Gene name
GPSM1, AGS3
Definition
(RefSeq) G protein signaling modulator 1
  KO
K15839  G-protein signaling modulator 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa05030  Cocaine addiction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09165 Substance dependence
   05030 Cocaine addiction
    26086 (GPSM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPR_12 GoLoco TPR_1 TPR_7 TPR_2 TPR_10 TPR_8 TPR_MalT Rapsyn_N TPR_16
Motif
Other DBs
NCBI-GeneID: 26086
NCBI-ProteinID: NP_001139110
OMIM: 609491
HGNC: 17858
Ensembl: ENSG00000160360
Vega: OTTHUMG00000020930
Pharos: Q86YR5(Tbio)
UniProt: Q86YR5 A0A0A0MSK4
LinkDB All DBs
Position
9q34.3
AA seq 675 aa AA seqDB search
MAGPAPPAADELPGPAARRLYSRMEASCLELALEGERLCKAGDFKTGVAFFEAAVQVGTE
DLKTLSAIYSQLGNAYFYLKEHGRALEYHKHDLLLARTIGDRMGEAKASGNLGNTLKVLG
RFDEAAVCCQRHLSIAQEQGDKVGEARALYNIGNVYHAKGKQLSWNAANATQDPGHLPPD
VRETLCKASEFYERNLSLVKELGDRAAQGRAYGNLGNTHYLLGNFTEATTFHKERLAIAK
EFGDKAAERRAYSNLGNAHVFLGRFDVAAEYYKKTLQLSRQLRDQAVEAQACYSLGNTYT
LLQDYERAAEYHLRHLLIAQELADRVGEGRACWSLGNAYVSMGRPAQALTFAKKHLQISQ
EIGDRHGELTARMNVAQLQLVLGRLTSPAASEKPDLAGYEAQGARPKRTQRLSAETWDLL
RLPLEREQNGDSHHSGDWRGPSRDSLPLPVRSRKYQEGPDAERRPREGSHSPLDSADVRV
HVPRTSIPRAPSSDEECFFDLLTKFQSSRMDDQRCPLDDGQAGAAEATAAPTLEDRIAQP
SMTASPQTEEFFDLIASSQSRRLDDQRASVGSLPGLRITHSNAGHLRGHGEPQEPGDDFF
NMLIKYQSSRIDDQRCPPPDVLPRGPTMPDEDFFSLIQRVQAKRMDEQRVDLAGGPEQGA
GGPPEPQQQCQPGAS
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcccggccccgcccgcggccgacgagctcccgggcccggccgccaggcgcctc
tactccaggatggaggcgtcctgcctagagctggcgctggagggcgagcgtctgtgcaag
gcgggcgacttcaagacaggcgtggccttctttgaggctgctgtgcaggtgggcaccgag
gacctgaagacactgagtgccatctacagccagctgggcaacgcctacttctacctgaag
gagcacggccgggcgctggaataccacaagcatgacctcctgctggcgcggaccatcggt
gaccgcatgggggaggccaaggccagtggaaacctgggaaacacactcaaggtcctgggg
cgcttcgacgaggctgccgtctgctgccagcggcatctgagcatcgcccaagagcaggga
gacaaggttggggaggcgagggccctctacaacatcgggaacgtgtaccacgccaaaggc
aagcaactgtcctggaacgccgcaaacgccacgcaggaccccgggcacctgccgcccgat
gtccgagagaccctgtgcaaggcctccgagttctacgagaggaacctgtccctggtgaag
gagctgggcgaccgtgcggcgcagggcagggcctacggcaacctgggcaacacccactat
ttgttggggaacttcacagaggccacgaccttccacaaggagcgcctggccattgctaag
gagtttggagacaaggcagccgagaggagggcctacagcaacctggggaacgcccacgtc
ttcctggggcgctttgacgtggccgccgagtactacaagaagacgctgcaactgtctcgg
cagctcagggaccaggcagtggaggcgcaggcctgctacagtctgggcaacacctacacg
ctgctgcaggactacgagcgcgcggccgagtaccacctgcggcacctgctcattgcccag
gagctggccgacagagtgggcgagggccgggcgtgctggagcctgggaaatgcctacgtg
tccatggggcgcccagcgcaggccctgaccttcgccaagaagcacctgcagatctcccag
gagatcggggaccgccatggggagctcacggcccgcatgaacgtggcgcagctgcagctg
gtgctcggccgcctgaccagcccggcagcctcagagaagcctgacctggccggctatgag
gcccagggggccagacccaagaggacgcagaggctgagcgcggagacctgggacctgctg
agactccccctggagcgggagcagaatggagacagccaccattcaggggactggcggggg
cccagcagggactcgctacccctccccgtgaggagcaggaagtaccaggaaggcccggac
gctgagaggaggccccgggagggcagccactccccgctggacagcgccgacgtccgggtg
cacgtgccacgcacgagcatcccgagggccccgtcttcggacgaggagtgcttctttgac
ctgttgaccaagttccagagcagccgcatggacgaccagcgttgtcccctggacgatggc
caggccggggctgccgaggccacggccgcccccaccctggaggacaggatcgcccagccc
tcgatgacggcctcgccccagaccgaggaattcttcgacctcatcgccagctcccagagc
cgccggctggacgaccagcgggccagcgtgggcagcctgccggggctgcgaatcacccac
agcaatgcagggcacctccgaggccacggcgagccccaggagccgggggacgacttcttc
aacatgctcatcaagtaccagtcctccaggatcgatgaccagcgctgcccgccacctgac
gtactgccccggggccctaccatgccggacgaggacttcttcagcctcattcagagggtg
caggctaagcgcatggacgagcagcgggtggacctcgccgggggcccggagcagggggca
ggcggcccgcccgagccccagcagcagtgccagcctggtgcgagctaa

DBGET integrated database retrieval system