KEGG   Homo sapiens (human): 2618
Entry
2618              CDS       T01001                                 

Gene name
GART, AIRS, GARS, GARTF, PAIS, PGFT, PRGS
Definition
(RefSeq) phosphoribosylglycinamide formyltransferase, phosphoribosylglycinamide synthetase, phosphoribosylaminoimidazole synthetase
  KO
K11787  phosphoribosylamine--glycine ligase / phosphoribosylglycinamide formyltransferase / phosphoribosylformylglycinamidine cyclo-ligase [EC:6.3.4.13 2.1.2.2 6.3.3.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa00670  One carbon pool by folate
hsa01100  Metabolic pathways
hsa01523  Antifolate resistance
Module
hsa_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Drug target
Lometrexol sodium: D04766
Pelitrexol: D05400
Pemetrexed (DG00682): D03828 D06503<JP/US> D07472 D10596 D11352
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    2618 (GART)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    2618 (GART)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    2618 (GART)
Enzymes [BR:hsa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.2  phosphoribosylglycinamide formyltransferase
     2618 (GART)
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.3  Cyclo-ligases
    6.3.3.1  phosphoribosylformylglycinamidine cyclo-ligase
     2618 (GART)
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.13  phosphoribosylamine---glycine ligase
     2618 (GART)
SSDB
Motif
Pfam: GARS_A Formyl_trans_N AIRS_C GARS_N GARS_C AIRS CPSase_L_D2 ATP-grasp ATP-grasp_2 ATP-grasp_3 ATP-grasp_4 Dala_Dala_lig_C Sacchrp_dh_NADP RimK
Other DBs
NCBI-GeneID: 2618
NCBI-ProteinID: NP_000810
OMIM: 138440
HGNC: 4163
Ensembl: ENSG00000159131
Vega: OTTHUMG00000065628
Pharos: P22102(Tchem)
UniProt: P22102
LinkDB
Structure
PDB: 

Position
21q22.11
AA seq 1010 aa
MAARVLIIGSGGREHTLAWKLAQSHHVKQVLVAPGNAGTACSEKISNTAISISDHTALAQ
FCKEKKIEFVVVGPEAPLAAGIVGNLRSAGVQCFGPTAEAAQLESSKRFAKEFMDRHGIP
TAQWKAFTKPEEACSFILSADFPALVVKASGLAAGKGVIVAKSKEEACKAVQEIMQEKAF
GAAGETIVIEELLDGEEVSCLCFTDGKTVAPMPPAQDHKRLLEGDGGPNTGGMGAYCPAP
QVSNDLLLKIKDTVLQRTVDGMQQEGTPYTGILYAGIMLTKNGPKVLEFNCRFGDPECQV
ILPLLKSDLYEVIQSTLDGLLCTSLPVWLENHTALTVVMASKGYPGDYTKGVEITGFPEA
QALGLEVFHAGTALKNGKVVTHGGRVLAVTAIRENLISALEEAKKGLAAIKFEGAIYRKD
VGFRAIAFLQQPRSLTYKESGVDIAAGNMLVKKIQPLAKATSRSGCKVDLGGFAGLFDLK
AAGFKDPLLASGTDGVGTKLKIAQLCNKHDTIGQDLVAMCVNDILAQGAEPLFFLDYFSC
GKLDLSVTEAVVAGIAKACGKAGCALLGGETAEMPDMYPPGEYDLAGFAVGAMERDQKLP
HLERITEGDVVVGIASSGLHSNGFSLVRKIVAKSSLQYSSPAPDGCGDQTLGDLLLTPTR
IYSHSLLPVLRSGHVKAFAHITGGGLLENIPRVLPEKLGVDLDAQTWRIPRVFSWLQQEG
HLSEEEMARTFNCGVGAVLVVSKEQTEQILRDIQQHKEEAWVIGSVVARAEGSPRVKVKN
LIESMQINGSVLKNGSLTNHFSFEKKKARVAVLISGTGSNLQALIDSTREPNSSAQIDIV
ISNKAAVAGLDKAERAGIPTRVINHKLYKNRVEFDSAIDLVLEEFSIDIVCLAGFMRILS
GPFVQKWNGKMLNIHPSLLPSFKGSNAHEQALETGVTVTGCTVHFVAEDVDAGQIILQEA
VPVKRGDTVATLSERVKLAEHKIFPAALQLVASGTVQLGENGKICWVKEE
NT seq 3033 nt   +upstreamnt  +downstreamnt
atggcagcccgagtacttataattggcagtggaggaagggaacatacgctggcctggaaa
cttgcacagtctcatcatgtcaaacaagtgttggttgccccaggaaacgcaggcactgcc
tgctctgaaaagatttcaaataccgccatctcaatcagtgaccacactgcccttgctcaa
ttctgcaaagagaagaaaattgaatttgtagttgttggaccagaagcacctctggctgct
gggattgttgggaacctgaggtctgcaggagtgcaatgctttggcccaacagcagaagcg
gctcagttagagtccagcaaaaggtttgccaaagagtttatggacagacatggaatccca
accgcacaatggaaggctttcaccaaacctgaagaagcctgcagcttcattttgagtgca
gacttccctgctttggttgtgaaggccagtggtcttgcagctggaaaaggggtgattgtt
gcaaagagcaaagaagaggcctgcaaagctgtacaagagatcatgcaggagaaagccttt
ggggcagctggagaaacaattgtcattgaagaacttcttgacggagaagaggtgtcgtgt
ctgtgtttcactgatggcaagactgtggcccccatgcccccagcacaggaccataagcga
ttactggagggagatggtggccctaacacagggggaatgggagcctattgtccagcccct
caggtttctaatgatctattactaaaaattaaagatactgttcttcagaggacagtggat
ggcatgcagcaagagggtactccatatacaggtattctctatgctggaataatgctgacc
aagaatggcccaaaagttctagagtttaattgccgttttggtgatccagagtgccaagta
atcctcccacttcttaaaagtgatctttatgaagtgattcagtccaccttagatggactg
ctctgcacatctctgcctgtttggctagaaaaccacaccgccctaactgttgtcatggca
agtaaaggttatcctggagactacaccaagggtgtagagataacagggtttcctgaggct
caagctctaggactggaggtgttccatgcaggcactgccctcaaaaatggcaaagtagta
actcatgggggtagagttcttgcagtcacagccatccgggaaaatctcatatcagccctt
gaggaagccaagaaaggactagctgctataaagtttgagggagcaatttataggaaagac
gtcggctttcgtgccatagctttcctccagcagcccaggagtttgacttacaaggaatct
ggagtagatatcgcagctggaaatatgctggtcaagaaaattcagcctttagcaaaagcc
acttccagatcaggctgtaaagttgatcttggaggttttgctggtctttttgatttaaaa
gcagctggtttcaaagatccccttctggcctctggaacagatggcgttggaactaaacta
aagattgcccagctatgcaataaacatgataccattggtcaagatttggtagcaatgtgt
gttaatgatattctggcacaaggagcagagcccctcttcttccttgattacttttcctgt
ggaaaacttgacctcagtgtaactgaagctgttgttgctggaattgctaaagcttgtgga
aaagctggatgtgctctccttggaggtgaaacagcagaaatgcctgacatgtatccccct
ggagagtatgacctagctgggtttgccgttggtgccatggagcgagatcagaaactccct
cacctggaaagaatcactgagggtgatgttgttgttggaatagcttcatctggtcttcat
agcaatggatttagccttgtgaggaaaatcgtggcaaaatcttccctccagtactcctct
ccagcacctgatggttgtggtgaccagactttaggggacttacttctcacgcctaccaga
atctacagccattcactgttacctgtcctacgttcaggacatgtcaaagcctttgcccat
attactggtggaggattactagagaacatccccagagtcctccctgagaaacttggggta
gatttagatgcccagacctggaggatccccagggtcttctcatggttgcagcaggaagga
cacctctctgaggaagagatggccagaacatttaactgtggggttggcgctgtccttgtg
gtatcaaaggagcagacagagcagattctgagggatatccagcagcacaaggaagaagcc
tgggtgattggcagtgtggttgcacgagctgaaggttccccacgtgtgaaagtcaagaat
ctgattgaaagcatgcaaataaatgggtcagtgttgaagaatggctccctgacaaatcat
ttctcttttgaaaaaaaaaaggccagagtggctgtcttaatatctggaacaggatcgaac
ctgcaagcacttatagacagtactcgggaaccaaatagctctgcacaaattgatattgtt
atctccaacaaagccgcagtagctgggttagataaagcggaaagagctggtattcccact
agagtaattaatcataaactgtataaaaatcgtgtagaatttgacagtgcaattgaccta
gtccttgaagagttctccatagacatagtctgtcttgcaggattcatgagaattctttct
ggcccctttgtccaaaagtggaatggaaaaatgctcaatatccacccatccttgctccct
tcttttaagggttcaaatgcccatgagcaagccctggaaaccggagtcacagttactggg
tgcactgtacactttgtagctgaagatgtggatgctggacagattattttgcaagaagct
gttcccgtgaagaggggtgatactgtcgcaactctttctgaaagagtaaaattagcagaa
cataaaatatttcctgcagcccttcagctggtggccagtggaactgtacagcttggagaa
aatggcaagatctgttgggttaaagaggaatga

DBGET integrated database retrieval system