KEGG   Homo sapiens (human): 26291Help
Entry
26291             CDS       T01001                                 

Gene name
FGF21
Definition
(RefSeq) fibroblast growth factor 21
  KO
K22429  fibroblast growth factor 21
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04714  Thermogenesis
hsa04810  Regulation of actin cytoskeleton
hsa05200  Pathways in cancer
hsa05218  Melanoma
hsa05224  Breast cancer
hsa05226  Gastric cancer
Network
nt06210  ERK signaling
nt06214  PI3K signaling
nt06261  Gastric cancer
nt06265  Bladder cancer
nt06270  Breast cancer
  Element
N00019  FGF-FGFR-RAS-ERK signaling pathway
N00037  FGF-FGFR-PI3K signaling pathway
Drug target
Pegbelfermin: D11512
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    26291 (FGF21)
   04015 Rap1 signaling pathway
    26291 (FGF21)
   04010 MAPK signaling pathway
    26291 (FGF21)
   04151 PI3K-Akt signaling pathway
    26291 (FGF21)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    26291 (FGF21)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    26291 (FGF21)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    26291 (FGF21)
  09162 Cancer: specific types
   05226 Gastric cancer
    26291 (FGF21)
   05218 Melanoma
    26291 (FGF21)
   05224 Breast cancer
    26291 (FGF21)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    26291 (FGF21)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    26291 (FGF21)
Cytokines and growth factors [BR:hsa04052]
 Growth factors
  Growth factors (RTK binding)
   26291 (FGF21)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   26291 (FGF21)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FGF
Motif
Other DBs
NCBI-GeneID: 26291
NCBI-ProteinID: NP_061986
OMIM: 609436
HGNC: 3678
Ensembl: ENSG00000105550
Vega: OTTHUMG00000183326
Pharos: Q9NSA1(Tbio)
UniProt: Q9NSA1
LinkDB All DBs
Position
19q13.33
AA seq 209 aa AA seqDB search
MDSDETGFEHSGLWVSVLAGLLLGACQAHPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAH
LEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEA
CSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGI
LAPQPPDVGSSDPLSMVGPSQGRSPSYAS
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atggactcggacgagaccgggttcgagcactcaggactgtgggtttctgtgctggctggt
cttctgctgggagcctgccaggcacaccccatccctgactccagtcctctcctgcaattc
gggggccaagtccggcagcggtacctctacacagatgatgcccagcagacagaagcccac
ctggagatcagggaggatgggacggtggggggcgctgctgaccagagccccgaaagtctc
ctgcagctgaaagccttgaagccgggagttattcaaatcttgggagtcaagacatccagg
ttcctgtgccagcggccagatggggccctgtatggatcgctccactttgaccctgaggcc
tgcagcttccgggagctgcttcttgaggacggatacaatgtttaccagtccgaagcccac
ggcctcccgctgcacctgccagggaacaagtccccacaccgggaccctgcaccccgagga
ccagctcgcttcctgccactaccaggcctgccccccgcactcccggagccacccggaatc
ctggccccccagccccccgatgtgggctcctcggaccctctgagcatggtgggaccttcc
cagggccgaagccccagctacgcttcctga

DBGET integrated database retrieval system