KEGG   Homo sapiens (human): 2641Help
Entry
2641              CDS       T01001                                 

Gene name
GCG, GLP-1, GLP1, GLP2, GRPP
Definition
(RefSeq) glucagon
  KO
K05259  glucagon
Organism
hsa  Homo sapiens (human)
Pathway
hsa04024  cAMP signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04714  Thermogenesis
hsa04911  Insulin secretion
hsa04922  Glucagon signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    2641 (GCG)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2641 (GCG)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    2641 (GCG)
   04922 Glucagon signaling pathway
    2641 (GCG)
  09159 Environmental adaptation
   04714 Thermogenesis
    2641 (GCG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hormone_2 MPM1
Motif
Other DBs
NCBI-GeneID: 2641
NCBI-ProteinID: NP_002045
OMIM: 138030
HGNC: 4191
Ensembl: ENSG00000115263
Vega: OTTHUMG00000153892
Pharos: P01275(Tbio)
CPD: C01501 C16049 C16050 C16048 C18197
UniProt: P01275
LinkDB All DBs
Structure
PDB: 

Position
2q24.2
AA seq 180 aa AA seqDB search
MKSIYFVAGLFVMLVQGSWQRSLQDTEEKSRSFSASQADPLSDPDQMNEDKRHSQGTFTS
DYSKYLDSRRAQDFVQWLMNTKRNRNNIAKRHDEFERHAEGTFTSDVSSYLEGQAAKEFI
AWLVKGRGRRDFPEEVAIVEELGRRHADGSFSDEMNTILDNLAARDFINWLIQTKITDRK
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagcatttactttgtggctggattatttgtaatgctggtacaaggcagctggcaa
cgttcccttcaagacacagaggagaaatccagatcattctcagcttcccaggcagaccca
ctcagtgatcctgatcagatgaacgaggacaagcgccattcacagggcacattcaccagt
gactacagcaagtatctggactccaggcgtgcccaagattttgtgcagtggttgatgaat
accaagaggaacaggaataacattgccaaacgtcacgatgaatttgagagacatgctgaa
gggacctttaccagtgatgtaagttcttatttggaaggccaagctgccaaggaattcatt
gcttggctggtgaaaggccgaggaaggcgagatttcccagaagaggtcgccattgttgaa
gaacttggccgcagacatgctgatggttctttctctgatgagatgaacaccattcttgat
aatcttgccgccagggactttataaactggttgattcagaccaaaatcactgacaggaaa
taa

DBGET integrated database retrieval system