KEGG   Homo sapiens (human): 2642
Entry
2642              CDS       T01001                                 

Gene name
GCGR, GGR, GL-R
Definition
(RefSeq) glucagon receptor
  KO
K04583  glucagon receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04922  Glucagon signaling pathway
Drug target
Crotedumab: D11230
Dasiglucagon: D11359
Glucagon (DG00511): D00116 D02118
Volagidemab: D11614
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2642 (GCGR)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    2642 (GCGR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    2642 (GCGR)
G protein-coupled receptors [BR:hsa04030]
 Secretin receptor family
  Pancreatic peptide
   Glucagon
    2642 (GCGR)
SSDB
Motif
Pfam: 7tm_2 HRM Dicty_CAR VSP
Other DBs
NCBI-GeneID: 2642
NCBI-ProteinID: NP_000151
OMIM: 138033
HGNC: 4192
Ensembl: ENSG00000215644
Vega: OTTHUMG00000177914
Pharos: P47871(Tclin)
UniProt: P47871
LinkDB
Structure
PDB: 
4ERS 4LF3

Position
17q25.3
AA seq 477 aa
MPPCQPQRPLLLLLLLLACQPQVPSAQVMDFLFEKWKLYGDQCHHNLSLLPPPTELVCNR
TFDKYSCWPDTPANTTANISCPWYLPWHHKVQHRFVFKRCGPDGQWVRGPRGQPWRDASQ
CQMDGEEIEVQKEVAKMYSSFQVMYTVGYSLSLGALLLALAILGGLSKLHCTRNAIHANL
FASFVLKASSVLVIDGLLRTRYSQKIGDDLSVSTWLSDGAVAGCRVAAVFMQYGIVANYC
WLLVEGLYLHNLLGLATLPERSFFSLYLGIGWGAPMLFVVPWAVVKCLFENVQCWTSNDN
MGFWWILRFPVFLAILINFFIFVRIVQLLVAKLRARQMHHTDYKFRLAKSTLTLIPLLGV
HEVVFAFVTDEHAQGTLRSAKLFFDLFLSSFQGLLVAVLYCFLNKEVQSELRRRWHRWRL
GKVLWEERNTSNHRASSSPGHGPPSKELQFGRGGGSQDSSAETPLAGGLPRLAESPF
NT seq 1434 nt   +upstreamnt  +downstreamnt
atgcccccctgccagccacagcgacccctgctgctgttgctgctgctgctggcctgccag
ccacaggtcccctccgctcaggtgatggacttcctgtttgagaagtggaagctctacggt
gaccagtgtcaccacaacctgagcctgctgccccctcccacggagctggtgtgcaacaga
accttcgacaagtattcctgctggccggacacccccgccaataccacggccaacatctcc
tgcccctggtacctgccttggcaccacaaagtgcaacaccgcttcgtgttcaagagatgc
gggcccgacggtcagtgggtgcgtggaccccgggggcagccttggcgtgatgcctcccag
tgccagatggatggcgaggagattgaggtccagaaggaggtggccaagatgtacagcagc
ttccaggtgatgtacacagtgggctacagcctgtccctgggggccctgctcctcgccttg
gccatcctggggggcctcagcaagctgcactgcacccgcaatgccatccacgcgaatctg
tttgcgtccttcgtgctgaaagccagctccgtgctggtcattgatgggctgctcaggacc
cgctacagccagaaaattggcgacgacctcagtgtcagcacctggctcagtgatggagcg
gtggctggctgccgtgtggccgcggtgttcatgcaatatggcatcgtggccaactactgc
tggctgctggtggagggcctgtacctgcacaacctgctgggcctggccaccctccccgag
aggagcttcttcagcctctacctgggcatcggctggggtgcccccatgctgttcgtcgtc
ccctgggcagtggtcaagtgtctgttcgagaacgtccagtgctggaccagcaatgacaac
atgggcttctggtggatcctgcggttccccgtcttcctggccatcctgatcaacttcttc
atcttcgtccgcatcgttcagctgctcgtggccaagctgcgggcacggcagatgcaccac
acagactacaagttccggctggccaagtccacgctgaccctcatccctctgctgggcgtc
cacgaagtggtcttcgccttcgtgacggacgagcacgcccagggcaccctgcgctccgcc
aagctcttcttcgacctcttcctcagctccttccagggcctgctggtggctgtcctctac
tgcttcctcaacaaggaggtgcagtcggagctgcggcggcgttggcaccgctggcgcctg
ggcaaagtgctatgggaggagcggaacaccagcaaccacagggcctcatcttcgcccggc
cacggccctcccagcaaggagctgcagtttgggaggggtggtggcagccaggattcatct
gcggagacccccttggctggtggcctccctagattggctgagagccccttctga

DBGET integrated database retrieval system