KEGG   Homo sapiens (human): 26508Help
Entry
26508             CDS       T01001                                 

Gene name
HEYL, HESR3, HEY3, HRT3, bHLHb33
Definition
(RefSeq) hes related family bHLH transcription factor with YRPW motif like
  KO
K09091  hairy and enhancer of split related with YRPW motif
Organism
hsa  Homo sapiens (human)
Pathway
hsa04330  Notch signaling pathway
hsa05165  Human papillomavirus infection
hsa05200  Pathways in cancer
hsa05224  Breast cancer
Network
nt06216  NOTCH signaling
nt06270  Breast cancer
  Element
N00087  NOTCH-overexpression to Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    26508 (HEYL)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    26508 (HEYL)
  09162 Cancer: specific types
   05224 Breast cancer
    26508 (HEYL)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    26508 (HEYL)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    26508 (HEYL)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Hairy, Hairy/E(SPL)
    26508 (HEYL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HLH Hairy_orange
Motif
Other DBs
NCBI-GeneID: 26508
NCBI-ProteinID: NP_055386
OMIM: 609034
HGNC: 4882
Ensembl: ENSG00000163909
Vega: OTTHUMG00000000458
Pharos: Q9NQ87(Tbio)
UniProt: Q9NQ87
LinkDB All DBs
Position
1p34.2
AA seq 328 aa AA seqDB search
MKRPKEPSGSDGESDGPIDVGQEGQLSQMARPLSTPSSSQMQARKKHRGIIEKRRRDRIN
SSLSELRRLVPTAFEKQGSSKLEKAEVLQMTVDHLKMLHATGGTGFFDARALAVDFRSIG
FRECLTEVIRYLGVLEGPSSRADPVRIRLLSHLNSYAAEMEPSPTPTGPLAFPAWPWSFF
HSCPGLPALSNQLAILGRVPSPVLPGVSSPAYPIPALRTAPLRRATGIILPARRNVLPSR
GASSTRRARPLERPATPVPVAPSSRAARSSHIAPLLQSSSPTPPGPTGSAAYVAVPTPNS
SSPGPAGRPAGAMLYHSWVSEITEIGAF
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgacccaaggagccgagcggctccgacggggagtccgacggacccatcgacgtg
ggccaagagggccagctgagccagatggccaggccgctgtccacccccagctcttcgcag
atgcaagccaggaagaaacacagagggatcatagagaaacggcgtcgagaccgcatcaac
agtagcctttctgaattgcgacgcttggtccccactgcctttgagaaacagggctcttcc
aagctggagaaagccgaggtcttgcagatgacggtggatcacttgaaaatgctccatgcc
actggtgggacaggattctttgatgcccgagccctggcagttgacttccggagcattggt
tttcgggagtgcctcactgaggtcatcaggtacctgggggtccttgaagggcccagcagc
cgtgcagaccccgtccggattcgccttctctcccacctcaacagctacgcagccgagatg
gagccttcgcccacgcccactggccctttggccttccctgcctggccctggtctttcttc
catagctgtccagggctgccagccctgagcaaccagctcgccatcctgggaagagtgccc
agccctgtcctccccggtgtctcctctcctgcttaccccatcccagccctccgaaccgct
ccccttcgcagagccacaggcatcatcctgccagcccggaggaatgtgctgcccagtcga
ggggcatcttccacccggagggcccgccccctagagaggccagcgacccctgtgcctgtc
gcccccagcagcagggctgccaggagcagccacatcgctcccctcctgcagtcttcctcc
ccaacaccccctggtcctacagggtcggctgcttacgtggctgttcccacccccaactca
tcctccccagggccagctgggaggccagcgggagccatgctctaccactcctgggtctct
gaaatcactgaaatcggggctttctga

DBGET integrated database retrieval system