KEGG   Homo sapiens (human): 2668
Entry
2668              CDS       T01001                                 

Gene name
GDNF, ATF, ATF1, ATF2, HFB1-GDNF, HSCR3
Definition
(RefSeq) glial cell derived neurotrophic factor
  KO
K05452  glial cell derived neurotrophic factor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
Disease
H00910  Hirschsprung disease
H00916  Congenital central hypoventilation syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    2668 (GDNF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    2668 (GDNF)
Cytokines and growth factors [BR:hsa04052]
 Growth factors
  Growth factors (RTK binding)
   2668 (GDNF)
SSDB
Motif
Pfam: TGF_beta
Other DBs
NCBI-GeneID: 2668
NCBI-ProteinID: NP_000505
OMIM: 600837
HGNC: 4232
Ensembl: ENSG00000168621
Vega: OTTHUMG00000090809
Pharos: P39905(Tbio)
UniProt: P39905 A0A0S2Z3V2
LinkDB
Structure
PDB: 
3FUB 2V5E 6Q2N 4UX8

Position
5p13.2
AA seq 211 aa
MKLWDVVAVCLVLLHTASAFPLPAGKRPPEAPAEDRSLGRRRAPFALSSDSNMPEDYPDQ
FDDVMDFIQATIKRLKRSPDKQMAVLPRRERNRQAAAANPENSRGKGRRGQRGKNRGCVL
TAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILKNLSRNRRLVSDKVGQACCR
PIAFDDDLSFLDDNLVYHILRKHSAKRCGCI
NT seq 636 nt   +upstreamnt  +downstreamnt
atgaagttatgggatgtcgtggctgtctgcctggtgctgctccacaccgcgtccgccttc
ccgctgcccgccggtaagaggcctcccgaggcgcccgccgaagaccgctccctcggccgc
cgccgcgcgcccttcgcgctgagcagtgactcaaatatgccagaggattatcctgatcag
ttcgatgatgtcatggattttattcaagccaccattaaaagactgaaaaggtcaccagat
aaacaaatggcagtgcttcctagaagagagcggaatcggcaggctgcagctgccaaccca
gagaattccagaggaaaaggtcggagaggccagaggggcaaaaaccggggttgtgtctta
actgcaatacatttaaatgtcactgacttgggtctgggctatgaaaccaaggaggaactg
atttttaggtactgcagcggctcttgcgatgcagctgagacaacgtacgacaaaatattg
aaaaacttatccagaaatagaaggctggtgagtgacaaagtagggcaggcatgttgcaga
cccatcgcctttgatgatgacctgtcgtttttagatgataacctggtttaccatattcta
agaaagcattccgctaaaaggtgtggatgtatctga

DBGET integrated database retrieval system