KEGG   Homo sapiens (human): 2691
Entry
2691              CDS       T01001                                 

Gene name
GHRH, GHRF, GRF, INN
Definition
(RefSeq) growth hormone releasing hormone
  KO
K05260  growth hormone-releasing hormone
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04935  Growth hormone synthesis, secretion and action
Network
nt06324  GHRH-GH-IGF signaling
  Element
N00910  GHRHR-PKA-GH signaling pathway
N00911  Mutation-inactivated GHRHR to GHRHR-PKA-GH signaling pathway
Disease
H01700  Hypopituitarism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2691 (GHRH)
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    2691 (GHRH)
SSDB
Motif
Pfam: Hormone_2
Other DBs
NCBI-GeneID: 2691
NCBI-ProteinID: NP_066567
OMIM: 139190
HGNC: 4265
Ensembl: ENSG00000118702
Vega: OTTHUMG00000032413
Pharos: P01286(Tbio)
CPD: C16085
UniProt: P01286
LinkDB
Position
20q11.23
AA seq 108 aa
MPLWVFFFVILTLSNSSHCSPPPPLTLRMRRYADAIFTNSYRKVLGQLSARKLLQDIMSR
QQGESNQERGARARLGRQVDSMWAEQKQMELESILVALLQKHSRNSQG
NT seq 327 nt   +upstreamnt  +downstreamnt
atgccactctgggtgttcttctttgtgatcctcaccctcagcaacagctcccactgctcc
ccacctccccctttgaccctcaggatgcggcggtatgcagatgccatcttcaccaacagc
taccggaaggtgctgggccagctgtccgcccgcaagctgctccaggacatcatgagcagg
cagcagggagagagcaaccaagagcgaggagcaagggcacggcttggtcgtcaggtagac
agcatgtgggcagaacaaaagcaaatggaattggagagcatcctggtggccctgctgcag
aagcacagcaggaactcccagggatga

DBGET integrated database retrieval system