KEGG   Homo sapiens (human): 2695Help
Entry
2695              CDS       T01001                                 

Gene name
GIP
Definition
(RefSeq) gastric inhibitory polypeptide
  KO
K05258  gastric inhibitory polypeptide
Organism
hsa  Homo sapiens (human)
Pathway
hsa04024  cAMP signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04911  Insulin secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    2695 (GIP)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2695 (GIP)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    2695 (GIP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hormone_2
Motif
Other DBs
NCBI-GeneID: 2695
NCBI-ProteinID: NP_004114
OMIM: 137240
HGNC: 4270
Ensembl: ENSG00000159224
Vega: OTTHUMG00000161171
Pharos: P09681(Tchem)
CPD: C15906
UniProt: P09681
LinkDB All DBs
Structure
PDB: 

Position
17q21.32
AA seq 153 aa AA seqDB search
MVATKTFALLLLSLFLAVGLGEKKEGHFSALPSLPVGSHAKVSSPQPRGPRYAEGTFISD
YSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQREARALELASQANRKEEEAVEPQSSPA
KNPSDEDLLRDLLIQELLACLLDQTNLCRLRSR
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atggtggccacgaagacctttgctctgctgctgctgtccctgttcctggcagtgggacta
ggagagaagaaagagggtcacttcagcgctctcccctccctgcctgttggatctcatgct
aaggtgagcagccctcaacctcgaggccccaggtacgcggaagggactttcatcagtgac
tacagtattgccatggacaagattcaccaacaagactttgtgaactggctgctggcccaa
aaggggaagaagaatgactggaaacacaacatcacccagagggaggctcgggcgctggag
ctggccagtcaagctaataggaaggaggaggaggcagtggagccacagagctccccagcc
aagaaccccagcgatgaagatttgctgcgggacttgctgattcaagagctgttggcctgc
ttgctggatcagacaaacctctgcaggctcaggtctcggtga

DBGET integrated database retrieval system