KEGG   Homo sapiens (human): 27005Help
Entry
27005             CDS       T01001                                 

Gene name
USP21, USP16, USP23
Definition
(RefSeq) ubiquitin specific peptidase 21
  KO
K21634  ubiquitin carboxyl-terminal hydrolase 21 [EC:3.4.19.12]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    27005 (USP21)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    27005 (USP21)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    27005 (USP21)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     27005 (USP21)
Peptidases and inhibitors [BR:hsa01002]
 Cysteine peptidases
  Family C19: ubiquitin-specific protease family
   27005 (USP21)
Ubiquitin system [BR:hsa04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    27005 (USP21)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UCH UCH_1 NifQ
Motif
Other DBs
NCBI-GeneID: 27005
NCBI-ProteinID: NP_001014443
OMIM: 604729
HGNC: 12620
Ensembl: ENSG00000143258
Vega: OTTHUMG00000033154
Pharos: Q9UK80(Tbio)
UniProt: Q9UK80
LinkDB All DBs
Structure
PDB: 

Position
1q23.3
AA seq 565 aa AA seqDB search
MPQASEHRLGRTREPPVNIQPRVGSKLPFAPRARSKERRNPASGPNPMLRPLPPRPGLPD
ERLKKLELGRGRTSGPRPRGPLRADHGVPLPGSPPPTVALPLPSRTNLARSKSVSSGDLR
PMGIALGGHRGTGELGAALSRLALRPEPPTLRRSTSLRRLGGFPGPPTLFSIRTEPPASH
GSFHMISARSSEPFYSDDKMAHHTLLLGSGHVGLRNLGNTCFLNAVLQCLSSTRPLRDFC
LRRDFRQEVPGGGRAQELTEAFADVIGALWHPDSCEAVNPTRFRAVFQKYVPSFSGYSQQ
DAQEFLKLLMERLHLEINRRGRRAPPILANGPVPSPPRRGGALLEEPELSDDDRANLMWK
RYLEREDSKIVDLFVGQLKSCLKCQACGYRSTTFEVFCDLSLPIPKKGFAGGKVSLRDCF
NLFTKEEELESENAPVCDRCRQKTRSTKKLTVQRFPRILVLHLNRFSASRGSIKKSSVGV
DFPLQRLSLGDFASDKAGSPVYQLYALCNHSGSVHYGHYTALCRCQTGWHVYNDSRVSPV
SENQVASSEGYVLFYQLMQEPPRCL
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atgccccaggcctctgagcaccgcctgggccgtacccgagagccacctgttaatatccag
ccccgagtgggatccaagctaccatttgcccccagggcccgcagcaaggagcgcagaaac
ccagcctctgggccaaaccccatgttacgacctctgcctccccggccaggtctgcctgat
gaacggctcaagaaactggagctgggacggggacggacctcaggccctcgtcccagaggc
ccccttcgagcagatcatggggttcccctgcctggctcaccacccccaacagtggctttg
cctctcccatctcggaccaacttagcccgttccaagtctgtgagcagtggggacttgcgt
ccaatggggattgccttgggagggcaccgtggcaccggagagcttggggctgcactgagc
cgcttggccctccggcctgagccacccactttgagacgtagcacttctctccgccgccta
gggggctttcctggaccccctaccctgttcagcatacggacagagccccctgcttcccat
ggctccttccacatgatatccgcccggtcctctgagcctttctactctgatgacaagatg
gctcatcacacactccttctgggctctggtcatgttggccttcgaaacctgggaaacacg
tgcttcctgaatgctgtgctgcagtgtctgagcagcactcgacctcttcgggacttctgt
ctgagaagggacttccggcaagaggtgcctggaggaggccgagcccaagagctcactgaa
gcctttgcagatgtgattggtgccctctggcaccctgactcctgcgaagctgtgaatcct
actcgattccgagctgtcttccagaaatatgttccctccttctctggatacagccagcag
gatgcccaagagttcctgaagctcctcatggagcggctacaccttgaaatcaaccgccga
ggccgccgggctccaccgatacttgccaatggtccagttccctctccaccccgccgagga
ggggctctgctagaagaacctgagttaagtgatgatgaccgagccaacctaatgtggaaa
cgttacctggagcgagaggacagcaagattgtggacctgtttgtgggccagttgaaaagt
tgtctcaagtgccaggcctgtgggtatcgctccacgaccttcgaggttttttgtgacctg
tccctgcccatccccaagaaaggatttgctgggggcaaggtgtctctgcgggattgtttc
aaccttttcactaaggaagaagagctagagtcggagaatgccccagtgtgtgaccgatgt
cggcagaaaactcgaagtaccaaaaagttgacagtacaaagattccctcgaatcctcgtg
ctccatctgaatcgattttctgcctcccgaggctccatcaaaaaaagttcagtaggtgta
gactttccactgcagcgactgagcctaggggactttgccagtgacaaagccggaagtcct
gtataccagctgtatgccctttgcaaccactcaggcagcgtccactatggccactacaca
gccctgtgccggtgccagactggttggcatgtctacaatgactctcgtgtctcccctgtc
agtgaaaaccaggtggcatccagcgagggctacgtgctgttctaccaactgatgcaggag
ccaccccggtgcctgtga

DBGET integrated database retrieval system