KEGG   Homo sapiens (human): 27071
Entry
27071             CDS       T01001                                 

Gene name
DAPP1, BAM32
Definition
(RefSeq) dual adaptor of phosphotyrosine and 3-phosphoinositides 1
  KO
K12229  dual adapter for phosphotyrosine and 3-phosphotyrosine and 3-phosphoinositide
Organism
hsa  Homo sapiens (human)
Pathway
hsa04662  B cell receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04662 B cell receptor signaling pathway
    27071 (DAPP1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:hsa04990]
    27071 (DAPP1)
Domain-containing proteins not elsewhere classified [BR:hsa04990]
 Pleckstrin homology (PH) domain-containing proteins
  Other PH domain-containing proteins
   27071 (DAPP1)
SSDB
Motif
Pfam: SH2 PH PH_11
Other DBs
NCBI-GeneID: 27071
NCBI-ProteinID: NP_055210
OMIM: 605768
HGNC: 16500
Ensembl: ENSG00000070190
Vega: OTTHUMG00000160974
Pharos: Q9UN19(Tbio)
UniProt: Q9UN19
LinkDB
Structure
PDB: 
1FAO 1FB8

Position
4q23
AA seq 280 aa
MGRAELLEGKMSTQDPSDLWSRSDGEAELLQDLGWYHGNLTRHAAEALLLSNGCDGSYLL
RDSNETTGLYSLSVRAKDSVKHFHVEYTGYSFKFGFNEFSSLKDFVKHFANQPLIGSETG
TLMVLKHPYPRKVEEPSIYESVRVHTAMQTGRTEDDLVPTAPSLGTKEGYLTKQGGLVKT
WKTRWFTLHRNELKYFKDQMSPEPIRILDLTECSAVQFDYSQERVNCFCLVFPFRTFYLC
AKTGVEADEWIKILRWKLSQIRKQLNQGEGTIRSRSFIFK
NT seq 843 nt   +upstreamnt  +downstreamnt
atgggcagagcagaacttctagaagggaagatgagcacccaggatccctcagatctgtgg
agcagatccgatggagaggctgagctgctccaggacttggggtggtatcacggcaacctc
acacgccatgctgctgaagctcttctcctctcaaatggatgtgacggcagctaccttctg
agggacagcaatgagaccaccgggctgtactctctctctgtgagggccaaagattctgtt
aaacactttcatgttgaatatactggatattcatttaaatttggctttaatgaattctca
tctttgaaggattttgtcaagcattttgcaaatcagcctttgattggaagcgagacaggc
actctgatggttctaaaacatccctacccaagaaaagtggaagaaccctccatttatgaa
tctgtccgggttcacacagcaatgcagacaggaagaacagaagatgaccttgtgcccaca
gcaccttctctgggcaccaaagaaggttacctcaccaaacagggaggcctggtcaagacc
tggaaaacaagatggtttactctgcacaggaatgaactgaaatacttcaaagaccagatg
tcaccagaaccaattcggatcctagacctaacagaatgttcagctgtacaattcgattat
tcacaagaaagggtaaactgtttttgtttggtatttccattcaggacattttatctctgt
gcaaagaccggagtagaagctgatgagtggatcaagatattacgctggaaattgtcacaa
ataagaaaacagctcaaccaaggggaaggcacgatccgatctcggtcgttcatctttaaa
tag

DBGET integrated database retrieval system