KEGG   Homo sapiens (human): 2710
Entry
2710              CDS       T01001                                 

Gene name
GK, GK1, GKD
Definition
(RefSeq) glycerol kinase
  KO
K00864  glycerol kinase [EC:2.7.1.30]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00561  Glycerolipid metabolism
hsa01100  Metabolic pathways
hsa03320  PPAR signaling pathway
Disease
H02013  Glycerol kinase deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    2710 (GK)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    2710 (GK)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    2710 (GK)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     2710 (GK)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   2710 (GK)
SSDB
Motif
Pfam: FGGY_N FGGY_C DUF4501
Other DBs
NCBI-GeneID: 2710
NCBI-ProteinID: NP_001191948
OMIM: 300474
HGNC: 4289
Ensembl: ENSG00000198814
Vega: OTTHUMG00000021328
Pharos: P32189(Tbio)
UniProt: P32189 B4DH54
LinkDB
Position
Xp21.2
AA seq 559 aa
MAASKKAVLGPLVGAVDQGTSSTRFLVFNSKTAELLSHHQVEIKQEFPREGWVEQDPKEI
LHSVYECIEKTCEKLGQLNIDISNIKAIGVSNQRETTVVWDKITGEPLYNAVVWLDLRTQ
STVESLSKRIPGNNNFVKSKTGLPLSTYFSAVKLRWLLDNVRKVQKAVEEKRALFGTIDS
WLIWSLTGGVNGGVHCTDVTNASRTMLFNIHSLEWDKQLCEFFGIPMEILPNVRSSSEIY
GLMKISHSVKAGALEGVPISGCLGDQSAALVGQMCFQIGQAKNTYGTGCFLLCNTGHKCV
FSDHGLLTTVAYKLGRDKPVYYALEGSVAIAGAVIRWLRDNLGIIKTSEEIEKLAKEVGT
SYGCYFVPAFSGLYAPYWEPSARGIICGLTQFTNKCHIAFAALEAVCFQTREILDAMNRD
CGIPLSHLQVDGGMTSNKILMQLQADILYIPVVKPSMPETTALGAAMAAGAAEGVGVWSL
EPEDLSAVTMERFEPQINAEESEIRYSTWKKAVMKSMGWVTTQSPESGDPSIFCSLPLGF
FIVSSMVMLIGARYISGIP
NT seq 1680 nt   +upstreamnt  +downstreamnt
atggcagcctcaaagaaggcagttttggggccattggtgggggcggtggaccagggcacc
agttcgacgcgctttttggttttcaattcaaaaacagctgaactacttagtcatcatcaa
gtagaaataaaacaagagttcccaagagaaggatgggtggaacaggaccctaaggaaatt
ctacattctgtctatgagtgtatagagaaaacatgtgagaaacttggacagctcaatatt
gatatttccaacataaaagctattggtgtcagcaaccagagggaaaccactgtagtctgg
gacaagataactggagagcctctctacaatgctgtggtgtggcttgatctaagaacccag
tctaccgttgagagtcttagtaaaagaattccaggaaataataactttgtcaagtccaag
acaggccttccacttagcacttacttcagtgcagtgaaacttcgttggctccttgacaat
gtgagaaaagttcaaaaggccgttgaagaaaaacgagctctttttgggactattgattca
tggcttatttggagtttgacaggaggagtcaatggaggtgtccactgtacagatgtaaca
aatgcaagtaggactatgcttttcaacattcattctttggaatgggataaacaactctgc
gaattttttggaattccaatggaaattcttccaaatgtccggagttcttctgagatctat
ggcctaatgaaaatctctcatagcgtgaaagctggggccttggaaggtgtgccaatatct
gggtgtttaggggaccagtctgctgcattggtgggacaaatgtgcttccagattggacaa
gccaaaaatacgtatggaacaggatgtttcttactatgtaatacaggccataagtgtgta
ttttctgatcatggccttctcaccacagtggcttacaaacttggcagagacaaaccagta
tattatgctttggaaggttctgtagctatagctggtgctgttattcgctggctaagagac
aatcttggaattataaagacctcagaagaaattgaaaaacttgctaaagaagtaggtact
tcttatggctgctacttcgtcccagcattttcggggttatatgcaccttattgggagccc
agcgcaagagggataatctgtggactcactcagttcaccaataaatgccatattgctttt
gctgcattagaagctgtttgtttccaaactcgagagattttggatgccatgaatcgagac
tgtggaattccactcagtcatttgcaggtagatggaggaatgaccagcaacaaaattctt
atgcagctacaagcagacattctgtatataccagtagtgaagccctcaatgcccgaaacc
actgcactgggtgcggctatggcggcaggggctgcagaaggagtcggcgtatggagtctc
gaacccgaggatttgtctgccgtcacgatggagcggtttgaacctcagattaatgcggag
gaaagtgaaattcgttattctacatggaagaaagctgtgatgaagtcaatgggttgggtt
acaactcaatctccagaaagtggtgaccctagtatcttctgtagtctgcccttgggcttt
tttatagtgagtagcatggtaatgttaatcggagcaaggtacatctcaggtattccataa

KEGG   Homo sapiens (human): 2712
Entry
2712              CDS       T01001                                 

Gene name
GK2, GKP2, GKTA
Definition
(RefSeq) glycerol kinase 2
  KO
K00864  glycerol kinase [EC:2.7.1.30]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00561  Glycerolipid metabolism
hsa01100  Metabolic pathways
hsa03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    2712 (GK2)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    2712 (GK2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    2712 (GK2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     2712 (GK2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   2712 (GK2)
SSDB
Motif
Pfam: FGGY_N FGGY_C
Other DBs
NCBI-GeneID: 2712
NCBI-ProteinID: NP_149991
OMIM: 600148
HGNC: 4291
Ensembl: ENSG00000196475
Vega: OTTHUMG00000130199
Pharos: Q14410(Tdark)
UniProt: Q14410 A0A140VKG0
LinkDB
Position
4q21.21
AA seq 553 aa
MAAPKTAAVGPLVGAVVQGTNSTRFLVFNSKTAELLSHHKVELTQEFPKEGWVEQDPKEI
LQSVYECIARTCEKLDELNIDISNIKAVGVSNQRETTVIWDKLTGEPLYNAVVWLDLRTQ
TTVEDLSKKIPGNSNFVKSKTGLPLSTYFSAVKLRWMLDNVRNVQKAVEEGRALFGTIDS
WLIWSLTGGVNGGVHCTDVTNASRTMLFNIHSLEWDKELCDFFEIPMDLLPNVFSSSEIY
GLIKTGALEGVPISGCLGDQCAALVGQMCFQEGQAKNTYGTGCFLLCNTGRKCVFSEHGL
LTTVAYKLGREKPAYYALEGSVAIAGAVIRWLRDNLGIIETSGDIERLAKEVGTSYGCYF
VPAFSGLYAPYWEPSARGILCGLTQFTNKCHIAFAALEAVCFQTREILEAMNRDCGIPLR
HLQVDGGMTNNKVLMQLQADILHIPVIKPFMPETTALGAAMAAGAAEGVSVWSLEPQALS
VLRMERFEPQIQATESEIRYATWKKAVMKSMGWVTSQSPEGGDPSIFSSLPLGFFIVSSM
VMLIGARYISGVP
NT seq 1662 nt   +upstreamnt  +downstreamnt
atggcagccccaaagacagcagctgtggggccgttggtgggagcggtggtccagggcacc
aactccactcgctttctggttttcaattcaaaaacagcggaactacttagtcatcacaaa
gtggaattaacacaagagttcccaaaagaaggatgggtggaacaagaccctaaagaaatt
cttcagtctgtctacgagtgtatagcgagaacgtgtgagaaacttgacgaactgaatatt
gatatatccaacataaaagctgttggtgtcagcaatcagagggaaaccactgtaatctgg
gacaagttaacaggagagcctctctacaatgctgtggtgtggcttgatctaagaacccag
actactgttgaggatcttagtaaaaaaattccaggaaatagtaacttcgtcaagtctaag
acaggccttccactcagcacttacttcagtgcagtaaaacttcgttggatgcttgacaat
gtgagaaacgtccaaaaggctgttgaagaaggtagagctctttttggtaccattgattca
tggcttatctggagtttgacaggaggagttaatggaggcgtgcattgtacagatgtaaca
aatgcaagtaggacaatgctttttaatatccattctttggaatgggataaagagctctgt
gacttttttgaaattccaatggaccttcttccaaatgtcttcagttcttctgagatctat
ggcctaattaaaactggagccctggaaggtgtgccaatatctgggtgtttgggggaccaa
tgtgctgcattagtaggacaaatgtgcttccaggagggacaagccaaaaacacctatgga
acaggttgcttcttactgtgtaatacgggtcgtaaatgtgtgttttctgaacatggcctt
ttgaccacagtagcttacaaactaggcagagagaagccagcatattatgcactggaaggt
tctgttgctatagcaggtgctgttattcgttggctaagagacaatcttggaattatagag
acctcaggagacattgaaagacttgctaaagaagtaggaacttcttatggctgttacttt
gtcccagccttttcagggttatatgcaccttattgggagcccagtgcaagagggatactc
tgtggcctcactcagtttaccaataaatgtcatattgcttttgctgcattagaagctgtt
tgtttccaaacccgagagattttggaagccatgaaccgtgactgtggaattccacttcgt
catttgcaggtagatggaggaatgaccaacaacaaagttcttatgcagctacaagcagat
attcttcatattccagtaataaaaccctttatgcctgaaacaactgcactaggagctgcc
atggcagcaggggctgcagagggagtaagcgtttggagccttgaaccccaggctttgtca
gttctcaggatggaacgatttgaaccacagatccaggccacagaaagtgaaattcgttat
gccacatggaagaaagccgtaatgaagtcaatgggttgggttaccagtcagtctcctgaa
ggtggtgatccttctatcttctctagtctgcctttgggattttttatagtgagtagcatg
gtaatgctaattggagcaagatatatctcgggtgtgccataa

DBGET integrated database retrieval system