KEGG   Homo sapiens (human): 27102
Entry
27102             CDS       T01001                                 

Gene name
EIF2AK1, HCR, HRI, LEMSPAD, hHRI
Definition
(RefSeq) eukaryotic translation initiation factor 2 alpha kinase 1
  KO
K16194  eukaryotic translation initiation factor 2-alpha kinase 1 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
hsa05160  Hepatitis C
hsa05162  Measles
hsa05168  Herpes simplex virus 1 infection
Disease
H02457  Developmental delay, leukoencephalopathy, and neurologic decompensation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    27102 (EIF2AK1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    27102 (EIF2AK1)
   05162 Measles
    27102 (EIF2AK1)
   05168 Herpes simplex virus 1 infection
    27102 (EIF2AK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    27102 (EIF2AK1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     27102 (EIF2AK1)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: Other
  PEK family [OT]
   27102 (EIF2AK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH PKcGMP_CC
Other DBs
NCBI-GeneID: 27102
NCBI-ProteinID: NP_055228
OMIM: 613635
HGNC: 24921
Ensembl: ENSG00000086232
Vega: OTTHUMG00000090689
Pharos: Q9BQI3(Tchem)
UniProt: Q9BQI3 A0A024QZU1
LinkDB
Position
7p22.1
AA seq 630 aa
MQGGNSGVRKREEEGDGAGAVAAPPAIDFPAEGPDPEYDESDVPAEIQVLKEPLQQPTFP
FAVANQLLLVSLLEHLSHVHEPNPLRSRQVFKLLCQTFIKMGLLSSFTCSDEFSSLRLHH
NRAITHLMRSAKERVRQDPCEDISRIQKIRSREVALEAQTSRYLNEFEELAILGKGGYGR
VYKVRNKLDGQYYAIKKILIKGATKTVCMKVLREVKVLAGLQHPNIVGYHTAWIEHVHVI
QPRADRAAIELPSLEVLSDQEEDREQCGVKNDESSSSSIIFAEPTPEKEKRFGESDTENQ
NNKSVKYTTNLVIRESGELESTLELQENGLAGLSASSIVEQQLPLRRNSHLEESFTSTEE
SSEENVNFLGQTEAQYHLMLHIQMQLCELSLWDWIVERNKRGREYVDESACPYVMANVAT
KIFQELVEGVFYIHNMGIVHRDLKPRNIFLHGPDQQVKIGDFGLACTDILQKNTDWTNRN
GKRTPTHTSRVGTCLYASPEQLEGSEYDAKSDMYSLGVVLLELFQPFGTEMERAEVLTGL
RTGQLPESLRKRCPVQAKYIQHLTRRNSSQRPSAIQLLQSELFQNSGNVNLTLQMKIIEQ
EKEIAELKKQLNLLSQDKGVRDDGKDGGVG
NT seq 1893 nt   +upstreamnt  +downstreamnt
atgcaggggggcaactccggggtccgcaagcgcgaagaggagggcgacggggctggggct
gtggctgcgccgccggccatcgactttcccgccgagggcccggaccccgaatatgacgaa
tctgatgttccagcagaaatccaggtgttaaaagaacccctacaacagccaaccttccct
tttgcagttgcaaaccaactcttgctggtttctttgctggagcacttgagccacgtgcat
gaaccaaacccacttcgttcaagacaggtgtttaagctactttgccagacgtttatcaaa
atggggctgctgtcttctttcacttgtagtgacgagtttagctcattgagactacatcac
aacagagctattactcacttaatgaggtctgctaaagagagagttcgtcaggatccttgt
gaggatatttctcgtatccagaaaatcagatcaagggaagtagccttggaagcacaaact
tcacgttacttaaatgaatttgaagaacttgccatcttaggaaaaggtggatacggaaga
gtatacaaggtcaggaataaattagatggtcagtattatgcaataaaaaaaatcctgatt
aagggtgcaactaaaacagtttgcatgaaggtcctacgggaagtgaaggtgctggcaggt
cttcagcaccccaatattgttggctatcacaccgcgtggatagaacatgttcatgtgatt
cagccacgagcagacagagctgccattgagttgccatctctggaagtgctctccgaccag
gaagaggacagagagcaatgtggtgttaaaaatgatgaaagtagcagctcatccattatc
tttgctgagcccaccccagaaaaagaaaaacgctttggagaatctgacactgaaaatcag
aataacaagtcggtgaagtacaccaccaatttagtcataagagaatctggtgaacttgag
tcgaccctggagctccaggaaaatggcttggctggtttgtctgccagttcaattgtggaa
cagcagctgccactcaggcgtaattcccacctagaggagagtttcacatccaccgaagaa
tcttccgaagaaaatgtcaactttttgggtcagacagaggcacagtaccacctgatgctg
cacatccagatgcagctgtgtgagctctcgctgtgggattggatagtcgagagaaacaag
cggggccgggagtatgtggacgagtctgcctgtccttatgttatggccaatgttgcaaca
aaaatttttcaagaattggtagaaggtgtgttttacatacataacatgggaattgtgcac
cgagatctgaagccaagaaatatttttcttcatggccctgatcagcaagtaaaaatagga
gactttggtctggcctgcacagacatcctacagaagaacacagactggaccaacagaaac
gggaagagaacaccaacacatacgtccagagtgggtacttgtctgtacgcttcacccgaa
cagttggaaggatctgagtatgatgccaagtcagatatgtacagcttgggtgtggtcctg
ctagagctctttcagccgtttggaacagaaatggagcgagcagaagttctaacaggttta
agaactggtcagttgccggaatccctccgtaaaaggtgtccagtgcaagccaagtatatc
cagcacttaacgagaaggaactcatcgcagagaccatctgccattcagctgctgcagagt
gaacttttccaaaattctggaaatgttaacctcaccctacagatgaagataatagagcaa
gaaaaagaaattgcagaactaaagaagcagctaaacctcctttctcaagacaaaggggtg
agggatgacggaaaggatgggggcgtgggatga

KEGG   Homo sapiens (human): 440275
Entry
440275            CDS       T01001                                 

Gene name
EIF2AK4, GCN2, PVOD2
Definition
(RefSeq) eukaryotic translation initiation factor 2 alpha kinase 4
  KO
K16196  eukaryotic translation initiation factor 2-alpha kinase 4 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04140  Autophagy - animal
hsa04141  Protein processing in endoplasmic reticulum
hsa05160  Hepatitis C
hsa05162  Measles
hsa05168  Herpes simplex virus 1 infection
Disease
H01621  Pulmonary arterial hypertension
H01866  Pulmonary veno-occlusive disease and pulmonary capillary hemangiomatosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    440275 (EIF2AK4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    440275 (EIF2AK4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    440275 (EIF2AK4)
   05162 Measles
    440275 (EIF2AK4)
   05168 Herpes simplex virus 1 infection
    440275 (EIF2AK4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    440275 (EIF2AK4)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     440275 (EIF2AK4)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: Other
  PEK family [OT]
   440275 (EIF2AK4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr RWD HGTP_anticodon2 tRNA-synt_His Kinase-like Kdo
Other DBs
NCBI-GeneID: 440275
NCBI-ProteinID: NP_001013725
OMIM: 609280
HGNC: 19687
Ensembl: ENSG00000128829
Vega: OTTHUMG00000172403
Pharos: Q9P2K8(Tchem)
UniProt: Q9P2K8
LinkDB
Structure
PDB: 
6N3O 6N3L 6N3N

Position
15q15.1
AA seq 1649 aa
MAGGRGAPGRGRDEPPESYPQRQDHELQALEAIYGADFQDLRPDACGPVKEPPEINLVLY
PQGLTGEEVYVKVDLRVKCPPTYPDVVPEIELKNAKGLSNESVNLLKSRLEELAKKHCGE
VMIFELAYHVQSFLSEHNKPPPKSFHEEMLERRAQEEQQRLLEAKRKEEQEQREILHEIQ
RRKEEIKEEKKRKEMAKQERLEIASLSNQDHTSKKDPGGHRTAAILHGGSPDFVGNGKHR
ANSSGRSRRERQYSVCNSEDSPGSCEILYFNMGSPDQLMVHKGKCIGSDEQLGKLVYNAL
ETATGGFVLLYEWVLQWQKKMGPFLTSQEKEKIDKCKKQIQGTETEFNSLVKLSHPNVVR
YLAMNLKEQDDSIVVDILVEHISGVSLAAHLSHSGPIPVHQLRRYTAQLLSGLDYLHSNS
VVHKVLSASNVLVDAEGTVKITDYSISKRLADICKEDVFEQTRVRFSDNALPYKTGKKGD
VWRLGLLLLSLSQGQECGEYPVTIPSDLPADFQDFLKKCVCLDDKERWSPQQLLKHSFIN
PQPKMPLVEQSPEDSEGQDYVETVIPSNRLPSAAFFSETQRQFSRYFIEFEELQLLGKGA
FGAVIKVQNKLDGCCYAVKRIPINPASRQFRRIKGEVTLLSRLHHENIVRYYNAWIERHE
RPAGPGTPPPDSGPLAKDDRAARGQPASDTDGLDSVEAAAPPPILSSSVEWSTSGERSAS
ARFPATGPGSSDDEDDDEDEHGGVFSQSFLPASDSESDIIFDNEDENSKSQNQDEDCNEK
NGCHESEPSVTTEAVHYLYIQMEYCEKSTLRDTIDQGLYRDTVRLWRLFREILDGLAYIH
EKGMIHRDLKPVNIFLDSDDHVKIGDFGLATDHLAFSADSKQDDQTGDLIKSDPSGHLTG
MVGTALYVSPEVQGSTKSAYNQKVDLFSLGIIFFEMSYHPMVTASERIFVLNQLRDPTSP
KFPEDFDDGEHAKQKSVISWLLNHDPAKRPTATELLKSELLPPPQMEESELHEVLHHTLT
NVDGKAYRTMMAQIFSQRISPAIDYTYDSDILKGNFSIRTAKMQQHVCETIIRIFKRHGA
VQLCTPLLLPRNRQIYEHNEAALFMDHSGMLVMLPFDLRIPFARYVARNNILNLKRYCIE
RVFRPRKLDRFHPKELLECAFDIVTSTTNSFLPTAEIIYTIYEIIQEFPALQERNYSIYL
NHTMLLKAILLHCGIPEDKLSQVYIILYDAVTEKLTRREVEAKFCNLSLSSNSLCRLYKF
IEQKGDLQDLMPTINSLIKQKTGIAQLVKYGLKDLEEVVGLLKKLGIKLQVLINLGLVYK
VQQHNGIIFQFVAFIKRRQRAVPEILAAGGRYDLLIPQFRGPQALGPVPTAIGVSIAIDK
ISAAVLNMEESVTISSCDLLVVSVGQMSMSRAINLTQKLWTAGITAEIMYDWSQSQEELQ
EYCRHHEITYVALVSDKEGSHVKVKSFEKERQTEKRVLETELVDHVLQKLRTKVTDERNG
REASDNLAVQNLKGSFSNASGLFEIHGATVVPIVSVLAPEKLSASTRRRYETQVQTRLQT
SLANLHQKSSEIEILAVDLPKETILQFLSLEWDADEQAFNTTVKQLLSRLPKQRYLKLVC
DEIYNIKVEKKVSVLFLYSYRDDYYRILF
NT seq 4950 nt   +upstreamnt  +downstreamnt
atggctgggggccgtggggcccccgggcgcggccgggacgagcctccggagagctacccg
caacgacaggaccacgagctacaggccctggaggccatttacggcgcggacttccaagac
ctgcggccggacgcttgcggaccggtcaaagagccccctgaaatcaatttagttttgtac
cctcaaggcctaactggtgaagaagtatatgtaaaagtggatttgagggttaaatgccca
cctacctatccagatgtagttcctgaaatagagttaaaaaatgccaaaggtctatcaaat
gaaagtgtcaatttgttaaaatctcgcctagaagaactggccaagaaacactgtggggag
gtgatgatctttgaactggcttaccacgtgcagtcatttctcagcgagcataacaagccc
cctcccaagtcttttcatgaagaaatgctggaaaggcgggctcaggaggagcagcagagg
ctgttggaggccaagcggaaagaagagcaggagcaacgtgaaatcctgcatgagattcag
agaaggaaagaagagataaaagaagagaaaaaaaggaaagaaatggctaagcaggaacgt
ttggaaattgctagtttgtcaaaccaagatcatacctctaagaaggacccaggaggacac
agaacggctgccattctacatggaggctctcctgactttgtaggaaatggtaaacatcgg
gcaaactcctcaggaaggtctaggcgagaacgtcagtattctgtatgtaatagtgaagat
tctcctggctcttgtgaaattctgtatttcaatatggggagtcctgatcagctcatggtg
cacaaagggaaatgtattggcagtgatgaacaacttggaaaattagtctacaatgctttg
gaaacagccactggtggctttgtcttgttgtatgagtgggtccttcagtggcagaaaaaa
atgggtccattccttaccagtcaagaaaaagagaagattgataagtgcaaaaagcagatt
caaggaacagaaacagaattcaactcactggtaaaattgagccatccaaatgtagtacgc
taccttgcaatgaatctcaaagagcaagacgactccatcgtggtggacattttagtggag
cacattagtggggtctctcttgctgcacacctgagccactcaggccccatccctgtgcat
cagcttcgcaggtacacagctcagctcctgtcaggccttgattatctgcacagcaattct
gtggtgcataaggtcctgagtgcatctaatgtcttggtggatgcagaaggcaccgtcaag
attacggactatagcatttctaagcgcctcgcagacatttgcaaggaggatgtgtttgag
caaacccgagttcgttttagtgacaatgctctgccttataaaacggggaagaaaggagat
gtttggcgtcttggccttctgctgctgtccctcagccaaggacaggaatgtggagagtac
cctgtgaccatccctagtgacttaccagctgactttcaagattttctaaagaaatgtgtg
tgcttggatgacaaggaaagatggagtccccagcagttgttgaaacacagctttataaat
ccccagccaaaaatgcctctagtggaacaaagtcctgaagattctgaaggacaagattat
gttgagactgttattcctagcaaccggctacccagtgctgccttctttagtgagacacag
agacagttttcccgatacttcattgagtttgaagaattacaacttcttggtaaaggagct
tttggagctgtcatcaaggtgcagaacaagttggacggctgctgctacgcagtgaagcgc
atccccatcaacccggccagccggcagttccgcaggatcaagggcgaagtgacactgctg
tcacggctgcaccatgagaacattgtgcgctactacaacgcctggatcgagcggcacgag
cggccggcgggaccggggacgccgcccccggactccgggcccctggccaaggatgaccga
gctgcacgcgggcagccggcgagcgacacagacggcctggacagcgtagaggccgccgcg
ccgccacccatcctcagcagctcggtggagtggagcacttcgggcgagcgctcggccagt
gcccgtttccccgccaccggcccgggctccagcgatgacgaggacgacgacgaggacgag
cacggtggcgtcttctcccagtccttcctgcctgcttcagattctgaaagtgatattatc
tttgacaatgaagatgagaacagtaaaagtcagaatcaggatgaagattgcaatgaaaag
aatggctgccatgaaagtgagccatcagtgacgactgaggctgtgcactacctatacatc
cagatggagtactgtgagaagagcactttacgagacaccattgaccagggactgtatcga
gacaccgtcagactctggaggctttttcgagagattctggatggattagcttatatccat
gagaaaggaatgattcaccgggatttgaagcctgtcaacatttttttggattctgatgac
catgtgaaaataggtgattttggtttggcgacagaccatctagccttttctgctgacagc
aaacaagacgatcagacaggagacttgattaagtcagacccttcaggtcacttaactggg
atggttggcactgctctctatgtaagcccagaggtccaaggaagcaccaaatctgcatac
aaccagaaagtggatctcttcagcctgggaattatcttctttgagatgtcctatcacccc
atggtcacggcttcagaaaggatctttgttctcaaccaactcagagatcccacttcgcct
aagtttccagaagactttgacgatggagagcatgcaaagcagaaatcagtcatctcctgg
ctgttgaaccacgatccagcaaaacggcccacagccacagaactgctcaagagtgagctg
ctgcccccaccccagatggaggagtcagagctgcatgaagtgctgcaccacacgctgacc
aacgtggatgggaaggcctaccgcaccatgatggcccagatcttctcgcagcgcatctcc
cctgccatcgattacacctatgacagcgacatactgaagggcaacttctcaatccgtaca
gccaagatgcagcagcatgtgtgtgaaaccatcatccgcatctttaaaagacatggagct
gttcagttgtgtactccactactgcttccccgaaacagacaaatatatgagcacaacgaa
gctgccctattcatggaccacagcgggatgctggtgatgcttccttttgacctgcggatc
ccttttgcaagatatgtggcaagaaataatatattgaatttaaaacgatactgcatagaa
cgtgtgttcaggccgcgcaagttagatcgatttcatcccaaagaacttctggagtgtgca
tttgatattgtcacttctaccaccaacagctttctgcccactgctgaaattatctacact
atctatgaaatcatccaagagtttccagcacttcaggaaagaaattacagtatttatttg
aaccataccatgttattgaaagcaatactcttacactgtgggatcccagaagataaactc
agtcaagtctacattattctgtatgatgctgtgacagagaagctgacgaggagagaagtg
gaagctaaattttgtaatctgtctttgtcttctaatagtctgtgtcgactctacaagttt
attgaacagaagggagatttgcaagatcttatgccaacaataaattcattaataaaacag
aaaacaggtattgcacagttggtgaagtatggcttaaaagacctagaggaggttgttgga
ctgttgaagaaactcggcatcaagttacaggtcttgatcaatttgggcttggtttacaag
gtgcagcagcacaatggaatcatcttccagtttgtggctttcatcaaacgaaggcaaagg
gctgtacctgaaatcctcgcagctggaggcagatatgacctgctgattccccagtttaga
gggccacaagctctggggccagttcccactgccattggggtcagcatagctatagacaag
atatctgctgctgtcctcaacatggaggaatctgttacaataagctcttgtgacctcctg
gttgtaagtgttggccagatgtctatgtccagggccatcaacctaacccagaaactctgg
acagcaggcatcacagcagaaatcatgtacgactggtcacagtcccaagaggaattacaa
gagtactgcagacatcatgaaatcacctatgtggcccttgtctcggataaagaaggaagc
catgtcaaggttaagtctttcgagaaggaaaggcagacagagaagcgtgtgctggagact
gaacttgtggaccatgtactgcagaaactgaggactaaagtcactgatgaaaggaatggc
agagaagcttccgataatcttgcagtgcaaaatctgaaggggtcattttctaatgcttca
ggtttgtttgaaatccatggagcaacagtggttcccattgtgagtgtgctagccccggag
aagctgtcagccagcactaggaggcgctatgaaactcaggtacaaactcgacttcagacc
tcccttgccaacttacatcagaaaagcagtgaaattgaaattctggctgtggatctaccc
aaagaaacaatattacagtttttatcattagagtgggatgctgatgaacaggcatttaac
acaactgtgaagcagctgctgtcacgcctgccaaagcaaagatacctcaaattagtctgt
gatgaaatttataacatcaaagtagaaaaaaaggtgtctgtgctatttctgtacagctat
agagatgactactacagaatcttattttaa

KEGG   Homo sapiens (human): 5610
Entry
5610              CDS       T01001                                 

Gene name
EIF2AK2, EIF2AK1, LEUDEN, PKR, PPP1R83, PRKR
Definition
(RefSeq) eukaryotic translation initiation factor 2 alpha kinase 2
  KO
K16195  eukaryotic translation initiation factor 2-alpha kinase 2 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
hsa04217  Necroptosis
hsa05010  Alzheimer disease
hsa05160  Hepatitis C
hsa05162  Measles
hsa05164  Influenza A
hsa05165  Human papillomavirus infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05171  Coronavirus disease - COVID-19
hsa05203  Viral carcinogenesis
Network
nt06122  IFN signaling (viruses)
nt06138  PKR-eIF2alpha signaling (viruses)
nt06162  Hepatitis B virus (HBV)
nt06163  Hepatitis C virus (HCV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06169  Measles virus (MV)
nt06170  Influenza A virus (IAV)
nt06171  Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
nt06222  IFN signaling
nt06263  Hepatocellular carcinoma
  Element
N00150  Type I IFN signaling pathway
N00571  PKR-eIF2alpha signaling pathway
N00573  HSV US11 to PKR-eIF2alpha signaling pathway
N00696  MV C to PKR-eIF2alpha signaling pathway
N00725  IAV NS1 to PKR-eIF2alpha signaling pathway
N00726  IAV NP to PKR-eIF2alpha signaling pathway
Disease
H02457  Developmental delay, leukoencephalopathy, and neurologic decompensation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    5610 (EIF2AK2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    5610 (EIF2AK2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    5610 (EIF2AK2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    5610 (EIF2AK2)
  09172 Infectious disease: viral
   05160 Hepatitis C
    5610 (EIF2AK2)
   05171 Coronavirus disease - COVID-19
    5610 (EIF2AK2)
   05164 Influenza A
    5610 (EIF2AK2)
   05162 Measles
    5610 (EIF2AK2)
   05168 Herpes simplex virus 1 infection
    5610 (EIF2AK2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    5610 (EIF2AK2)
   05169 Epstein-Barr virus infection
    5610 (EIF2AK2)
   05165 Human papillomavirus infection
    5610 (EIF2AK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    5610 (EIF2AK2)
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    5610 (EIF2AK2)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    5610 (EIF2AK2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     5610 (EIF2AK2)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: Other
  PEK family [OT]
   5610 (EIF2AK2)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     5610 (EIF2AK2)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     5610 (EIF2AK2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr dsrm Kinase-like Pkinase_fungal Kdo DND1_DSRM FTA2
Other DBs
NCBI-GeneID: 5610
NCBI-ProteinID: NP_001129123
OMIM: 176871
HGNC: 9437
Ensembl: ENSG00000055332
Vega: OTTHUMG00000100962
Pharos: P19525(Tbio)
UniProt: P19525 Q8IW76
LinkDB
Structure
PDB: 

Position
2p22.2
AA seq 551 aa
MAGDLSAGFFMEELNTYRQKQGVVLKYQELPNSGPPHDRRFTFQVIIDGREFPEGEGRSK
KEAKNAAAKLAVEILNKEKKAVSPLLLTTTNSSEGLSMGNYIGLINRIAQKKRLTVNYEQ
CASGVHGPEGFHYKCKMGQKEYSIGTGSTKQEAKQLAAKLAYLQILSEETSVKSDYLSSG
SFATTCESQSNSLVTSTLASESSSEGDFSADTSEINSNSDSLNSSSLLMNGLRNNQRKAK
RSLAPRFDLPDMKETKYTVDKRFGMDFKEIELIGSGGFGQVFKAKHRIDGKTYVIKRVKY
NNEKAEREVKALAKLDHVNIVHYNGCWDGFDYDPETSDDSLESSDYDPENSKNSSRSKTK
CLFIQMEFCDKGTLEQWIEKRRGEKLDKVLALELFEQITKGVDYIHSKKLIHRDLKPSNI
FLVDTKQVKIGDFGLVTSLKNDGKRTRSKGTLRYMSPEQISSQDYGKEVDLYALGLILAE
LLHVCDTAFETSKFFTDLRDGIISDIFDKKEKTLLQKLLSKKPEDRPNTSEILRTLTVWK
KSPEKNERHTC
NT seq 1656 nt   +upstreamnt  +downstreamnt
atggctggtgatctttcagcaggtttcttcatggaggaacttaatacataccgtcagaag
cagggagtagtacttaaatatcaagaactgcctaattcaggacctccacatgataggagg
tttacatttcaagttataatagatggaagagaatttccagaaggtgaaggtagatcaaag
aaggaagcaaaaaatgccgcagccaaattagctgttgagatacttaataaggaaaagaag
gcagttagtcctttattattgacaacaacgaattcttcagaaggattatccatggggaat
tacataggccttatcaatagaattgcccagaagaaaagactaactgtaaattatgaacag
tgtgcatcgggggtgcatgggccagaaggatttcattataaatgcaaaatgggacagaaa
gaatatagtattggtacaggttctactaaacaggaagcaaaacaattggccgctaaactt
gcatatcttcagatattatcagaagaaacctcagtgaaatctgactacctgtcctctggt
tcttttgctactacgtgtgagtcccaaagcaactctttagtgaccagcacactcgcttct
gaatcatcatctgaaggtgacttctcagcagatacatcagagataaattctaacagtgac
agtttaaacagttcttcgttgcttatgaatggtctcagaaataatcaaaggaaggcaaaa
agatctttggcacccagatttgaccttcctgacatgaaagaaacaaagtatactgtggac
aagaggtttggcatggattttaaagaaatagaattaattggctcaggtggatttggccaa
gttttcaaagcaaaacacagaattgacggaaagacttacgttattaaacgtgttaaatat
aataacgagaaggcggagcgtgaagtaaaagcattggcaaaacttgatcatgtaaatatt
gttcactacaatggctgttgggatggatttgattatgatcctgagaccagtgatgattct
cttgagagcagtgattatgatcctgagaacagcaaaaatagttcaaggtcaaagactaag
tgccttttcatccaaatggaattctgtgataaagggaccttggaacaatggattgaaaaa
agaagaggcgagaaactagacaaagttttggctttggaactctttgaacaaataacaaaa
ggggtggattatatacattcaaaaaaattaattcatagagatcttaagccaagtaatata
ttcttagtagatacaaaacaagtaaagattggagactttggacttgtaacatctctgaaa
aatgatggaaagcgaacaaggagtaagggaactttgcgatacatgagcccagaacagatt
tcttcgcaagactatggaaaggaagtggacctctacgctttggggctaattcttgctgaa
cttcttcatgtatgtgacactgcttttgaaacatcaaagtttttcacagacctacgggat
ggcatcatctcagatatatttgataaaaaagaaaaaactcttctacagaaattactctca
aagaaacctgaggatcgacctaacacatctgaaatactaaggaccttgactgtgtggaag
aaaagcccagagaaaaatgaacgacacacatgttag

KEGG   Homo sapiens (human): 9451
Entry
9451              CDS       T01001                                 

Gene name
EIF2AK3, PEK, PERK, WRS
Definition
(RefSeq) eukaryotic translation initiation factor 2 alpha kinase 3
  KO
K08860  eukaryotic translation initiation factor 2-alpha kinase 3 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04137  Mitophagy - animal
hsa04140  Autophagy - animal
hsa04141  Protein processing in endoplasmic reticulum
hsa04210  Apoptosis
hsa04932  Non-alcoholic fatty liver disease
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05160  Hepatitis C
hsa05162  Measles
hsa05168  Herpes simplex virus 1 infection
Network
nt06412  Unfolded protein response (UPR) signaling
nt06460  Alzheimer disease
nt06463  Parkinson disease
nt06464  Amyotrophic lateral sclerosis
nt06465  Prion disease
  Element
N01009  PERK-ATF4 signaling pathway
N01010  Mutation-caused aberrant PSEN1 to PERK-ATF4 signaling pathway
N01035  Mutation-caused aberrant SNCA to PERK-ATF4 signaling pathway
N01149  Mutation-caused aberrant SOD1 to PERK-ATF4 signaling pathway
N01198  Scrapie conformation PrPSc to PERK-ATF4 signaling pathway
Disease
H00512  Permanent neonatal diabetes mellitus
H00766  Wolcott-Rallison syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    9451 (EIF2AK3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    9451 (EIF2AK3)
   04137 Mitophagy - animal
    9451 (EIF2AK3)
  09143 Cell growth and death
   04210 Apoptosis
    9451 (EIF2AK3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    9451 (EIF2AK3)
   05012 Parkinson disease
    9451 (EIF2AK3)
   05014 Amyotrophic lateral sclerosis
    9451 (EIF2AK3)
   05020 Prion disease
    9451 (EIF2AK3)
   05022 Pathways of neurodegeneration - multiple diseases
    9451 (EIF2AK3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    9451 (EIF2AK3)
  09172 Infectious disease: viral
   05160 Hepatitis C
    9451 (EIF2AK3)
   05162 Measles
    9451 (EIF2AK3)
   05168 Herpes simplex virus 1 infection
    9451 (EIF2AK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    9451 (EIF2AK3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     9451 (EIF2AK3)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: Other
  PEK family [OT]
   9451 (EIF2AK3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PQQ_2 Kinase-like Kdo APH
Other DBs
NCBI-GeneID: 9451
NCBI-ProteinID: NP_004827
OMIM: 604032
HGNC: 3255
Ensembl: ENSG00000172071
Vega: OTTHUMG00000155046
Pharos: Q9NZJ5(Tchem)
UniProt: Q9NZJ5 B3KY45
LinkDB
Structure
PDB: 

Position
2p11.2
AA seq 1116 aa
MERAISPGLLVRALLLLLLLLGLAARTVAAGRARGLPAPTAEAAFGLGAAAAPTSATRVP
AAGAVAAAEVTVEDAEALPAAAGEQEPRGPEPDDETELRPRGRSLVIISTLDGRIAALDP
ENHGKKQWDLDVGSGSLVSSSLSKPEVFGNKMIIPSLDGALFQWDQDRESMETVPFTVES
LLESSYKFGDDVVLVGGKSLTTYGLSAYSGKVRYICSALGCRQWDSDEMEQEEDILLLQR
TQKTVRAVGPRSGNEKWNFSVGHFELRYIPDMETRAGFIESTFKPNENTEESKIISDVEE
QEAAIMDIVIKVSVADWKVMAFSKKGGHLEWEYQFCTPIASAWLLKDGKVIPISLFDDTS
YTSNDDVLEDEEDIVEAARGATENSVYLGMYRGQLYLQSSVRISEKFPSSPKALESVTNE
NAIIPLPTIKWKPLIHSPSRTPVLVGSDEFDKCLSNDKFSHEEYSNGALSILQYPYDNGY
YLPYYKRERNKRSTQITVRFLDNPHYNKNIRKKDPVLLLHWWKEIVATILFCIIATTFIV
RRLFHPHPHRQRKESETQCQTENKYDSVSGEANDSSWNDIKNSGYISRYLTDFEPIQCLG
RGGFGVVFEAKNKVDDCNYAIKRIRLPNRELAREKVMREVKALAKLEHPGIVRYFNAWLE
APPEKWQEKMDEIWLKDESTDWPLSSPSPMDAPSVKIRRMDPFATKEHIEIIAPSPQRSR
SFSVGISCDQTSSSESQFSPLEFSGMDHEDISESVDAAYNLQDSCLTDCDVEDGTMDGND
EGHSFELCPSEASPYVRSRERTSSSIVFEDSGCDNASSKEEPKTNRLHIGNHCANKLTAF
KPTSSKSSSEATLSISPPRPTTLSLDLTKNTTEKLQPSSPKVYLYIQMQLCRKENLKDWM
NGRCTIEERERSVCLHIFLQIAEAVEFLHSKGLMHRDLKPSNIFFTMDDVVKVGDFGLVT
AMDQDEEEQTVLTPMPAYARHTGQVGTKLYMSPEQIHGNSYSHKVDIFSLGLILFELLYP
FSTQMERVRTLTDVRNLKFPPLFTQKYPCEYVMVQDMLSPSPMERPEAINIIENAVFEDL
DFPGKTVLRQRSRSLSSSGTKHSRQSNNSHSPLPSN
NT seq 3351 nt   +upstreamnt  +downstreamnt
atggagcgcgccatcagcccggggctgctggtacgggcgctgctgctgctgctgctgctg
ctggggctcgcggcaaggacggtggccgcggggcgcgcccgtggcctcccagcgccgacg
gcggaggcggcgttcggcctcggggcggccgctgctcccacctcagcgacgcgagtaccg
gcggcgggcgccgtggctgcggccgaggtgactgtggaggacgctgaggcgctgccggca
gccgcgggagagcaggagcctcggggtccggaaccagacgatgagacagagttgcgaccg
cgcggcaggtcattagtaattatcagcactttagatgggagaattgctgccttggatcct
gaaaatcatggtaaaaagcagtgggatttggatgtgggatccggttccttggtgtcatcc
agccttagcaaaccagaggtatttgggaataagatgatcattccttccctggatggagcc
ctcttccagtgggaccaagaccgtgaaagcatggaaacagttcctttcacagttgaatca
cttcttgaatcttcttataaatttggagatgatgttgttttggttggaggaaaatctctg
actacatatggactcagtgcatatagtggaaaggtgaggtatatctgttcagctctgggt
tgtcgccaatgggatagtgacgaaatggaacaagaggaagacatcctgcttctacagcgt
acccaaaaaactgttagagctgtcggacctcgcagtggcaatgagaagtggaatttcagt
gttggccactttgaacttcggtatattccagacatggaaacgagagccggatttattgaa
agcacctttaagcccaatgagaacacagaagagtctaaaattatttcagatgtggaagaa
caggaagctgccataatggacatagtgataaaggtttcggttgctgactggaaagttatg
gcattcagtaagaagggaggacatctggaatgggagtaccagttttgtactccaattgca
tctgcctggttacttaaggatgggaaagtcattcccatcagtctttttgatgatacaagt
tatacatctaatgatgatgttttagaagatgaagaagacattgtagaagctgccagagga
gccacagaaaacagtgtttacttgggaatgtatagaggccagctgtatctgcagtcatca
gtcagaatttcagaaaagtttccttcaagtcccaaggctttggaatctgtcactaatgaa
aacgcaattattcctttaccaacaatcaaatggaaacccttaattcattctccttccaga
actcctgtcttggtaggatctgatgaatttgacaaatgtctcagtaatgataagttttct
catgaagaatatagtaatggtgcactttcaatcttgcagtatccatatgataatggttat
tatctaccatactacaagagggagaggaacaaacgaagcacacagattacagtcagattc
ctcgacaacccacattacaacaagaatatccgcaaaaaggatcctgttcttcttttacac
tggtggaaagaaatagttgcaacgattttgttttgtatcatagcaacaacgtttattgtg
cgcaggcttttccatcctcatcctcacaggcaaaggaaggagtctgaaactcagtgtcaa
actgaaaataaatatgattctgtaagtggtgaagccaatgacagtagctggaatgacata
aaaaactctggatatatatcacgatatctaactgattttgagccaattcaatgcctggga
cgtggtggctttggagttgtttttgaagctaaaaacaaagtagatgactgcaattatgct
atcaagaggatccgtctccccaatagggaattggctcgggaaaaggtaatgcgagaagtt
aaagccttagccaagcttgaacacccgggcattgttagatatttcaatgcctggctcgaa
gcaccaccagagaagtggcaagaaaagatggatgaaatttggctgaaagatgaaagcaca
gactggccactcagctctcctagcccaatggatgcaccatcagttaaaatacgcagaatg
gatcctttcgctacaaaagaacatattgaaatcatagctccttcaccacaaagaagcagg
tctttttcagtagggatttcctgtgaccagacaagttcatctgagagccagttctcacca
ctggaattctcaggaatggaccatgaggacatcagtgagtcagtggatgcagcatacaac
ctccaggacagttgccttacagactgtgatgtggaagatgggactatggatggcaatgat
gaggggcactcctttgaactttgtccttctgaagcttctccttatgtaaggtcaagggag
agaacctcctcttcaatagtatttgaagattctggctgtgataatgcttccagtaaagaa
gagccgaaaactaatcgattgcatattggcaaccattgtgctaataaactaactgctttc
aagcccaccagtagcaaatcttcttctgaagctacattgtctatttctcctccaagacca
accactttaagtttagatctcactaaaaacaccacagaaaaactccagcccagttcacca
aaggtgtatctttacattcaaatgcagctgtgcagaaaagaaaacctcaaagactggatg
aatggacgatgtaccatagaggagagagagaggagcgtgtgtctgcacatcttcctgcag
atcgcagaggcagtggagtttcttcacagtaaaggactgatgcacagggacctcaagcca
tccaacatattctttacaatggatgatgtggtcaaggttggagactttgggttagtgact
gcaatggaccaggatgaggaagagcagacggttctgaccccaatgccagcttatgccaga
cacacaggacaagtagggaccaaactgtatatgagcccagagcagattcatggaaacagc
tattctcataaagtggacatcttttctttaggcctgattctatttgaattgctgtatcca
ttcagcactcagatggagagagtcaggaccttaactgatgtaagaaatctcaaatttcca
ccattatttactcagaaatatccttgtgagtacgtgatggttcaagacatgctctctcca
tcccccatggaacgacctgaagctataaacatcattgaaaatgctgtatttgaggacttg
gactttccaggaaaaacagtgctcagacagaggtctcgctccttgagttcatcgggaaca
aaacattcaagacagtccaacaactcccatagccctttgccaagcaattag

DBGET integrated database retrieval system