KEGG   Homo sapiens (human): 27128Help
Entry
27128             CDS       T01001                                 

Gene name
CYTH4, CYT4, DJ63G5.1, PSCD4, cytohesin-4
Definition
(RefSeq) cytohesin 4
  KO
K18441  cytohesin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04072  Phospholipase D signaling pathway
hsa04144  Endocytosis
hsa05130  Pathogenic Escherichia coli infection
hsa05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    27128 (CYTH4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    27128 (CYTH4)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    27128 (CYTH4)
   05132 Salmonella infection
    27128 (CYTH4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    27128 (CYTH4)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Arf GTPases and associated proteins
   Arf associated proteins
    27128 (CYTH4)
 Endosome - Golgi transport
   Arf GTPase associated proteins
    27128 (CYTH4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sec7 PH PH_11 PH_3 PH_8 MazG
Motif
Other DBs
NCBI-GeneID: 27128
NCBI-ProteinID: NP_037517
OMIM: 606514
HGNC: 9505
Ensembl: ENSG00000100055
Vega: OTTHUMG00000150562
Pharos: Q9UIA0(Tbio)
UniProt: Q9UIA0
LinkDB All DBs
Position
22q13.1
AA seq 394 aa AA seqDB search
MDLCHPEPAELSSGETEELQRIKWHRKQLLEDIQKLKDEIADVFAQIDCFESAEESRMAQ
KEKELCIGRKKFNMDPAKGIQYFIEHKLLTPDVQDIARFLYKGEGLNKTAIGTYLGERDP
INLQVLQAFVDCHEFANLNLVQALRQFLWSFRLPGEAQKIDRMMEAFATRYCLCNPGVFQ
STDTCYVLSFSIIMLNTSLHNPNVRDRPPFERFVSMNRGINNGSDLPEDQLRNLFDSIKS
EPFSIPEDDGNDLTHTFFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEFTTDKEPR
GIIPLENLSVQKVDDPKKPFCLELYNPSCRGQKIKACKTDGDGRVVEGKHESYRISATSA
EERDQWIESIRASITRVPFYDLVSTRKKKIASKQ
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggacctgtgccacccagagcccgcggagctgagcagcggggagacggaagagttacag
aggatcaagtggcaccgaaagcagctcctggaggacatccagaagctgaaggatgagatt
gcagatgtgtttgcccaaatcgactgcttcgagagtgcggaggagagccggatggcccag
aaggagaaggagctgtgtattgggcgcaagaagttcaacatggaccccgccaagggtatc
cagtatttcattgagcacaagctgctgacccctgacgtccaggacattgcacggttcctg
tataaaggcgagggcctcaacaagacagccattggtacctacctgggggagagggatccc
atcaacctgcaggtcctccaggccttcgtggactgccacgagttcgccaacctcaacctc
gtccaggccctcaggcagttcctgtggagcttccggctgccgggcgaggcccagaagata
gaccggatgatggaggcctttgccactcgatactgcctctgcaacccaggcgtcttccag
tccacagacacctgctacgtgttgtccttctccatcatcatgctcaacaccagcctccac
aatcccaacgtccgggacaggccgccttttgagcgctttgtgtccatgaaccgcggcatc
aacaatggtagcgacctgcccgaggaccagctgcggaacctcttcgacagcatcaagagt
gagccattctccatccctgaggacgacggcaatgacctcactcacaccttcttcaatcca
gaccgggagggttggctgctcaagctagggggccgcgtgaagacgtggaaacggcgctgg
ttcatcctgaccgacaactgcctctactacttcgagttcaccactgacaaggagccacgg
ggaattatacctcttgagaacctctcggtgcagaaggtggatgaccccaagaagccattc
tgcctggagctctacaaccctagctgccgaggccagaaaatcaaggcctgcaagaccgat
ggcgacggcagggtggtggagggcaagcacgaatcgtaccgcatctcagccaccagtgcc
gaggaacgtgaccagtggatcgagtccatccgagccagcatcacccgtgtccccttctac
gacctggtctctactcggaagaagaagattgccagcaagcagtga

KEGG   Homo sapiens (human): 9265Help
Entry
9265              CDS       T01001                                 

Gene name
CYTH3, ARNO3, GRP1, PSCD3, cytohesin-3
Definition
(RefSeq) cytohesin 3
  KO
K18441  cytohesin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04072  Phospholipase D signaling pathway
hsa04144  Endocytosis
hsa05130  Pathogenic Escherichia coli infection
hsa05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    9265 (CYTH3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    9265 (CYTH3)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    9265 (CYTH3)
   05132 Salmonella infection
    9265 (CYTH3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    9265 (CYTH3)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Arf GTPases and associated proteins
   Arf associated proteins
    9265 (CYTH3)
 Endosome - Golgi transport
   Arf GTPase associated proteins
    9265 (CYTH3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sec7 PH PH_11 PH_8 PH_3 SASRP1 GPS2_interact
Motif
Other DBs
NCBI-GeneID: 9265
NCBI-ProteinID: NP_004218
OMIM: 605081
HGNC: 9504
Ensembl: ENSG00000008256
Vega: OTTHUMG00000023440
Pharos: O43739(Tbio)
UniProt: O43739
LinkDB All DBs
Structure
PDB: 

Position
7p22.1
AA seq 399 aa AA seqDB search
MDEDGGGEGGGVPEDLSLEEREELLDIRRRKKELIDDIERLKYEIAEVMTEIDNLTSVEE
SKTTQRNKQIAMGRKKFNMDPKKGIQFLIENDLLQSSPEDVAQFLYKGEGLNKTVIGDYL
GERDEFNIKVLQAFVELHEFADLNLVQALRQFLWSFRLPGEAQKIDRMMEAFASRYCLCN
PGVFQSTDTCYVLSFAIIMLNTSLHNHNVRDKPTAERFIAMNRGINEGGDLPEELLRNLY
ESIKNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEYTT
DKEPRGIIPLENLSIREVEDPRKPNCFELYNPSHKGQVIKACKTEADGRVVEGNHVVYRI
SAPSPEEKEEWMKSIKASISRDPFYDMLATRKRRIANKK
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggatgaagacggcggcggcgagggtggtggcgtgcctgaagacctctcattagaagag
agagaagaacttctagacattcgtcgaagaaaaaaggaacttattgatgacattgagagg
ctgaaatatgaaattgcagaggtgatgacagagatcgacaatctaacttccgtagaggag
agcaaaacgactcagaggaacaaacagatagccatgggaagaaagaaattcaacatggat
cccaaaaagggaattcagtttctaatagaaaatgacctgctacagagttccccagaagac
gtcgcccagttcctttataaaggagaaggcctaaataagaccgtcattggggactacctg
ggtgaaagggatgaatttaatattaaagttcttcaagcctttgttgaactccatgagttt
gctgatctcaaccttgtacaagccttaaggcagttcttatggagcttcaggctgcccggg
gaggcgcagaagattgatcgcatgatggaggctttcgcttctcgctactgcctgtgcaac
cccggggtcttccagtccacagacacgtgctacgtgctgtcattcgccatcatcatgctc
aacaccagcctccacaaccacaacgtgcgtgacaagcccacggcagaacggttcatcgcc
atgaaccgcggcatcaacgagggcggggacctccctgaggagctgctgaggaatttgtat
gagagcattaagaacgagccatttaagatcccggaggacgacgggaacgacctgacccac
accttcttcaaccccgaccgcgagggctggctcctgaagctgggagggcgtgtgaagacc
tggaagcgccggtggttcatcctgaccgataactgcctctattactttgaatacacaaca
gataaggagcccaggggaatcatcccgttggaaaacctcagcatcagggaggtggaggac
ccccggaaacccaactgttttgagctctacaatcccagccacaaagggcaggtcatcaag
gcctgtaagactgaggccgacggccgcgtggtagaggggaaccatgtggtgtaccggatc
tcagccccgagcccggaggagaaggaggagtggatgaaatccatcaaagccagtatcagc
agagatcccttctatgacatgttggcaacgaggaaacgaaggattgccaataaaaaatag

KEGG   Homo sapiens (human): 9266Help
Entry
9266              CDS       T01001                                 

Gene name
CYTH2, ARNO, CTS18, CTS18.1, PSCD2, PSCD2L, SEC7L, Sec7p-L, Sec7p-like, cytohesin-2
Definition
(RefSeq) cytohesin 2
  KO
K18441  cytohesin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04072  Phospholipase D signaling pathway
hsa04144  Endocytosis
hsa05130  Pathogenic Escherichia coli infection
hsa05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    9266 (CYTH2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    9266 (CYTH2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    9266 (CYTH2)
   05132 Salmonella infection
    9266 (CYTH2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    9266 (CYTH2)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Arf GTPases and associated proteins
   Arf associated proteins
    9266 (CYTH2)
 Endosome - Golgi transport
   Arf GTPase associated proteins
    9266 (CYTH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sec7 PH PH_11 PH_8 PH_3 PH_16 NUDE_C
Motif
Other DBs
NCBI-GeneID: 9266
NCBI-ProteinID: NP_059431
OMIM: 602488
HGNC: 9502
Ensembl: ENSG00000105443
Vega: OTTHUMG00000150245
Pharos: Q99418(Tbio)
UniProt: Q99418
LinkDB All DBs
Structure
PDB: 

Position
19q13.33
AA seq 400 aa AA seqDB search
MEDGVYEPPDLTPEERMELENIRRRKQELLVEIQRLREELSEAMSEVEGLEANEGSKTLQ
RNRKMAMGRKKFNMDPKKGIQFLVENELLQNTPEEIARFLYKGEGLNKTAIGDYLGEREE
LNLAVLHAFVDLHEFTDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCLCNPGVFQ
STDTCYVLSFAVIMLNTSLHNPNVRDKPGLERFVAMNRGINEGGDLPEELLRNLYDSIRN
EPFKIPEDDGNDLTHTFFNPDREGWLLKLGGGRVKTWKRRWFILTDNCLYYFEYTTDKEP
RGIIPLENLSIREVDDPRKPNCFELYIPNNKGQLIKACKTEADGRVVEGNHMVYRISAPT
QEEKDEWIKSIQAAVSVDPFYEMLAARKKRISVKKKQEQP
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atggaggacggcgtctatgaacccccagacctgactccggaggagcggatggagctggag
aacatccggcggcggaagcaggagctgctggtggagattcagcgcctgcgggaggagctc
agtgaagccatgagcgaggtggaggggctggaggccaatgagggcagtaagaccttgcaa
cggaaccggaagatggcaatgggcaggaagaagttcaacatggaccccaagaaggggatc
cagttcttggtggagaatgaactgctgcagaacacacccgaggagatcgcccgcttcctg
tacaagggcgaggggctgaacaagacagccatcggggactacctgggggagagggaagaa
ctgaacctggcagtgctccatgcttttgtggatctgcatgagttcaccgacctcaatctg
gtgcaggccctcaggcagtttctatggagctttcgcctacccggagaggcccagaaaatt
gaccggatgatggaggccttcgcccagcgatactgcctgtgcaaccctggggttttccag
tccacagacacgtgctatgtgctgtccttcgccgtcatcatgctcaacaccagtctccac
aatcccaatgtccgggacaagccgggcctggagcgctttgtggccatgaaccggggcatc
aacgagggcggggacctgcctgaggagctgctcaggaacctgtacgacagcatccgaaat
gagcccttcaagattcctgaggatgacgggaatgacctgacccacaccttcttcaacccg
gaccgggagggctggctcctgaagctgggagggggccgggtgaagacgtggaagcggcgc
tggtttatcctcacagacaactgcctctactactttgagtacaccacggacaaggagccc
cgaggaatcatccccctggagaatctgagcatccgagaggtggacgacccccggaaaccg
aactgctttgaactttacatccccaacaacaaggggcagctcatcaaagcctgcaaaact
gaggcggacggccgagtggtggagggaaaccacatggtgtaccggatctcggcccccacg
caggaggagaaggacgagtggatcaagtccatccaggcggctgtgagtgtggaccccttc
tatgagatgctggcagcgagaaagaagcggatttcagtcaagaagaagcaggagcagccc
tga

KEGG   Homo sapiens (human): 9267Help
Entry
9267              CDS       T01001                                 

Gene name
CYTH1, B2-1, CYTOHESIN-1, D17S811E, PSCD1, SEC7
Definition
(RefSeq) cytohesin 1
  KO
K18441  cytohesin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04072  Phospholipase D signaling pathway
hsa04144  Endocytosis
hsa05130  Pathogenic Escherichia coli infection
hsa05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    9267 (CYTH1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    9267 (CYTH1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    9267 (CYTH1)
   05132 Salmonella infection
    9267 (CYTH1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    9267 (CYTH1)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Arf GTPases and associated proteins
   Arf associated proteins
    9267 (CYTH1)
 Endosome - Golgi transport
   Arf GTPase associated proteins
    9267 (CYTH1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sec7 PH PH_11 PH_8 PH_3 BBS2_C GPS2_interact FapA APG6_N Pilosulin SLX9 PH_16 CEP170_C Spc7
Motif
Other DBs
NCBI-GeneID: 9267
NCBI-ProteinID: NP_004753
OMIM: 182115
HGNC: 9501
Ensembl: ENSG00000108669
Vega: OTTHUMG00000150253
Pharos: Q15438(Tbio)
UniProt: Q15438
LinkDB All DBs
Structure
PDB: 

Position
17q25.3
AA seq 398 aa AA seqDB search
MEEDDSYVPSDLTAEERQELENIRRRKQELLADIQRLKDEIAEVANEIENLGSTEERKNM
QRNKQVAMGRKKFNMDPKKGIQFLIENDLLKNTCEDIAQFLYKGEGLNKTAIGDYLGERD
EFNIQVLHAFVELHEFTDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCQCNNGVF
QSTDTCYVLSFAIIMLNTSLHNPNVKDKPTVERFIAMNRGINDGGDLPEELLRNLYESIK
NEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGGRVKTWKRRWFILTDNCLYYFEYTTDKE
PRGIIPLENLSIREVEDSKKPNCFELYIPDNKDQVIKACKTEADGRVVEGNHTVYRISAP
TPEEKEEWIKCIKAAISRDPFYEMLAARKKKVSSTKRH
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggaggaggacgacagctacgttcccagtgacctgacagcagaggagcgtcaagaactg
gagaacatccgacggagaaaacaggagctgctggctgacattcagaggctgaaggatgag
atagcagaagtagctaatgaaattgaaaacctgggatccacagaggaaaggaaaaacatg
cagaggaacaaacaggtagccatgggcaggaaaaaatttaatatggaccctaaaaagggg
atccagttcttaatagagaacgacctcctgaagaacacttgtgaagacattgcccagttc
ttatataaaggcgaagggctcaacaagacagccatcggcgactacctaggggagagagat
gagtttaatatccaggttcttcatgcatttgtggagctgcatgagttcactgatcttaat
ctcgtccaggcactacggcagttcctgtggagcttccggctacccggagaggcccagaag
atcgaccggatgatggaggcgtttgcccagcgatattgtcagtgcaataatggcgtgttc
cagtccacggatacttgttacgtcctctcctttgccatcatcatgttgaacaccagtctg
cacaaccccaatgtcaaagataagcccactgtggagaggttcattgccatgaaccgaggc
atcaatgatgggggagacctgccggaggagctcctccggaatctctatgagagcataaaa
aatgaaccctttaaaatcccagaagacgacgggaatgacctcactcacactttcttcaat
ccagaccgagaaggctggctattgaaactcggaggtggcagggtaaagacttggaagaga
cgctggttcattctgactgacaactgcctttactactttgagtataccacggataaggag
ccccgtggaatcatccctttagagaatctgagtatccgggaagtggaggactccaaaaaa
ccaaactgctttgagctttatatccccgacaataaagaccaagttatcaaggcctgcaag
accgaggctgacgggcgggtggtggaggggaaccacactgtttaccggatctcagctccg
acgcccgaggagaaggaggagtggattaagtgcattaaagcagccatcagcagggaccct
ttctacgaaatgctcgcagcacggaaaaagaaggtctcctccacgaagcgacactga

DBGET integrated database retrieval system