KEGG   Homo sapiens (human): 27134
Entry
27134             CDS       T01001                                 

Gene name
TJP3, ZO-3, ZO3
Definition
(RefSeq) tight junction protein 3
  KO
K06097  tight junction protein 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04530  Tight junction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    27134 (TJP3)
SSDB
Motif
Pfam: PDZ PDZ_6 PDZ_2 SH3_2 Guanylate_kin
Other DBs
NCBI-GeneID: 27134
NCBI-ProteinID: NP_001254489
OMIM: 612689
HGNC: 11829
Ensembl: ENSG00000105289
Vega: OTTHUMG00000180872
Pharos: O95049(Tbio)
UniProt: O95049
LinkDB
Structure
PDB: 
3KFV

Position
19p13.3
AA seq 919 aa
MEELTIWEQHTATLSKDPRRGFGIAISGGRDRPGGSMVVSDVVPGGPAEGRLQTGDHIVM
VNGVSMENATSAFAIQILKTCTKMANITVKRPRRIHLPATKASPSSPGRQDSDEDDGPQR
VEEVDQGRGYDGDSSSGSGRSWDERSRRPRPGRRGRAGSHGRRSPGGGSEANGLALVSGF
KRLPRQDVQMKPVKSVLVKRRDSEEFGVKLGSQIFIKHITDSGLAARHRGLQEGDLILQI
NGVSSQNLSLNDTRRLIEKSEGKLSLLVLRDRGQFLVNIPPAVSDSDSSPLEDISDLASE
LSQAPPSHIPPPPRHAQRSPEASQTDSPVESPRLRRESSVDSRTISEPDEQRSELPRESS
YDIYRVPSSQSMEDRGYSPDTRVVRFLKGKSIGLRLAGGNDVGIFVSGVQAGSPADGQGI
QEGDQILQVNDVPFQNLTREEAVQFLLGLPPGEEMELVTQRKQDIFWKMVQSRVGDSFYI
RTHFELEPSPPSGLGFTRGDVFHVLDTLHPGPGQSHARGGHWLAVRMGRDLREQERGIIP
NQSRAEQLASLEAAQRAVGVGPGSSAGSNARAEFWRLRGLRRGAKKTTQRSREDLSALTR
QGRYPPYERVVLREASFKRPVVILGPVADIAMQKLTAEMPDQFEIAETVSRTDSPSKIIK
LDTVRVIAEKDKHALLDVTPSAIERLNYVQYYPIVVFFIPESRPALKALRQWLAPASRRS
TRRLYAQAQKLRKHSSHLFTATIPLNGTSDTWYQELKAIIREQQTRPIWTAEDQLDGSLE
DNLDLPHHGLADSSADLSCDSRVNSDYETDGEGGAYTDGEGYTDGEGGPYTDVDDEPPAP
ALARSSEPVQADESQSPRDRGRISAHQGAQVDSRHPQGQWRQDSMRTYEREALKKKFMRV
HDAESSDEDGYDWGPATDL
NT seq 2760 nt   +upstreamnt  +downstreamnt
atggaggagctgaccatctgggaacagcacacggccacactgtccaaggacccccgccgg
ggctttggcattgcgatctctggaggccgagaccggcccggtggatccatggttgtatct
gacgtggtacctggagggccggcggagggcaggctacagacaggcgaccacatcgtcatg
gtgaacggggtttccatggagaatgccacctccgcgtttgccattcagatactcaagacc
tgcaccaagatggccaacatcacagtgaaacgtccccggaggatccacctgcccgccacc
aaagccagcccctccagcccagggcgccaggactcggatgaagacgatgggccccagcgg
gtggaggaggtggaccagggccggggctatgacggcgactcatccagtggctccggccgc
tcctgggacgagcgctcccgccggccgaggcctggtcgccggggccgggccggcagccat
gggcgtaggagcccaggtggtggctctgaggccaacgggctggccctggtgtccggcttt
aagcggctgccacggcaggacgtgcagatgaagcctgtgaagtcagtgctggtgaagagg
agagacagcgaagagtttggcgtcaagctgggcagtcagatcttcatcaagcacattaca
gattcgggcctggctgcccggcaccgtgggctgcaggaaggagatctcattctacagatc
aacggggtgtctagccagaacctgtcactgaacgacacccggcgactgattgagaagtca
gaagggaagctaagcctgctggtgctgagagatcgtgggcagttcctggtgaacattccg
cctgctgtcagtgacagcgacagctcgccattggaggacatctcggacctcgcctcggag
ctatcgcaggcaccaccatcccacatcccaccaccaccccggcatgctcagcggagcccc
gaggccagccagaccgactctcccgtggagagtccccggcttcggcgggaaagttcagta
gattccagaaccatctcggaaccagatgagcaacggtcagagttgcccagggaaagcagc
tatgacatctacagagtgcccagcagtcagagcatggaggatcgtgggtacagccccgac
acgcgtgtggtccgcttcctcaagggcaagagcatcgggctgcggctggcagggggcaat
gacgtgggcatcttcgtgtccggggtgcaggcgggcagcccggccgacgggcagggcatc
caggagggagatcagattctgcaggtgaatgacgtgccattccagaacctgacacgggag
gaggcagtgcagttcctgctggggctgccaccaggcgaggagatggagctggtgacgcag
aggaagcaggacattttctggaaaatggtgcagtcccgcgtgggtgactccttctacatc
cgcactcactttgagctggagcccagtccaccgtctggcctgggcttcacccgtggcgac
gtcttccacgtgctggacacgctgcaccccggccccgggcagagccacgcacgaggaggc
cactggctggcggtgcgcatgggtcgtgacctgcgggagcaagagcggggcatcattccc
aaccagagcagggcggagcagctggccagcctggaagctgcccagagggccgtgggagtc
gggcccggctcctccgcgggctccaatgctcgggccgagttctggcggctgcggggtctt
cgtcgaggagccaagaagaccactcagcggagccgtgaggacctctcagctctgacccga
cagggccgctacccgccctacgaacgagtggtgttgcgagaagccagtttcaagcgcccg
gtagtgatcctgggacccgtggccgacattgctatgcagaagttgactgctgagatgcct
gaccagtttgaaatcgcagagactgtgtccaggaccgacagcccctccaagatcatcaaa
ctagacaccgtgcgggtgattgcagaaaaagacaagcatgcgctcctggatgtgaccccc
tccgccatcgagcgcctcaactatgtgcagtactaccccattgtggtcttcttcatcccc
gagagccggccggccctcaaggcactgcgccagtggctggcgcctgcctcccgccgcagc
acccgtcgcctctacgcacaagcccagaagctgcgaaaacacagcagccacctcttcaca
gccaccatccctctgaatggcacgagtgacacctggtaccaggagctcaaggccatcatt
cgagagcagcagacgcggcccatctggacggcggaagatcagctggatggctccttggag
gacaacctagacctccctcaccacggcctggccgacagctccgctgacctcagctgcgac
agccgcgttaacagcgactacgagacggacggcgagggcggcgcgtacacggatggcgag
ggctacacagacggcgagggggggccctacacggatgtggatgatgagcccccggctcca
gccctggcccggtcctcggagcccgtgcaggcagatgagtcccagagcccgagggatcgt
gggagaatctcggctcatcagggggcccaggtggacagccgccacccccagggacagtgg
cgacaggacagcatgcgaacctatgaacgggaagccctgaagaaaaagtttatgcgagta
catgatgcggagtcctccgatgaagacggctatgactggggtccggccactgacctgtga

DBGET integrated database retrieval system