KEGG   Homo sapiens (human): 27151Help
Entry
27151             CDS       T01001                                 

Gene name
CPAMD8, ASGD8, K-CAP, VIP
Definition
(RefSeq) C3 and PZP like alpha-2-macroglobulin domain containing 8
Organism
hsa  Homo sapiens (human)
Disease
H01159  Anterior segment dysgenesis
SSDB OrthologParalogGFIT
Motif
Pfam: TED_complement A2M_BRD Methyltransf_FA A2M A2M_recep MG2 MG3 MG4 Kazal_2 Kazal_1 MG1
Motif
Other DBs
NCBI-GeneID: 27151
NCBI-ProteinID: NP_056507
OMIM: 608841
HGNC: 23228
Ensembl: ENSG00000160111
Vega: OTTHUMG00000133549
Pharos: Q8IZJ3(Tdark)
UniProt: A0A494C0S9
LinkDB All DBs
Position
19p13.11
AA seq 1885 aa AA seqDB search
MSGALLWPLLPLLLLLLSARDGVRAAQPQAPGYLIAAPSVFRAGVEEVISVTIFNSPREV
TVQAQLVAQGEPVVQSQGAILDKGTIKLKVPTGLRGQALLKVWGRGWQAEEGPLFHNQTS
VTVDGRGASVFIQTDKPVYRPQHRVLISIFTVSPNLRPVNEKLEAYILDPRGSRMIEWRH
LKPFCCGITNMSFPLSDQPVLGEWFIFVEMQGHAYNKSFEVQKYVLPKFELLIDPPRYIQ
DLDACETGTVRARYTFGKPVAGALMINMTVNGVGYYSHEVGRPVLRTTKILGSRDFDICV
RDMIPADVPEHFRGRVSIWAMVTSVDGSQQVAFDDSTPVQRQLVDIRYSKDTRKQFKPGL
AYVGKVELSYPDGSPAEGVTVQIKAELTPKDNIYTSEVVSQRGLVGFEIPSIPTSAQHVW
LETKVMALNGKPVGAQYLPSYLSLGSWYSPSQCYLQLQPPSHPLQVGEEAYFSVKSTCPC
NFTLYYEVAARGNIVLSGQQPAHTTQQRSKRAAPALEKPIRLTHLSETEPPPAPEAEVDV
CVTSLHLAVTPSMVPLGRLLVFYVRENGEGVADSLQFAVETFFENQVSVTYSANETQPGE
VVDLRIRAARGSCVCVAAVDKSVYLLRSGFRLTPAQVFQELEDYDVSDSFGVSREDGPFW
WAGLTAQRRRRSSVFPWPWGITKDSGFAFTETGLVVMTDRVSLNHRQDGGLYTDEAVPAF
QPHTGSLVAVAPSRHPPRTEKRKRTFFPETWIWHCLNISDPSGEGTLSVKVPDSITSWVG
EAVALSTSQGLGIAEPSLLKTFKPFFVDFMLPALIIRGEQVKIPLSVYNYMGTCAEVYMK
LSVPKGIQFVGHPGKRHVTKKMCVAPGEAEPIWVVLSFSDLGLNNITAKALAYGDTNCCR
DGRSSKHPEENHADRRVPIGVDHVRRSVMVEAEGVPRAYTYSAFFCPSERVHISTPNKYE
FQYVQRPLRLTRFDVAVRAHNDARVALSSGPQDTAGMIEIVLGGHQNTRSWISTSKMGEP
VASAHTAKILSWDEFRTFWISWRGGLIQVGHGPEPSNESVIVAWTLPRPPEVQFIGFSTG
WGSMGEFRIWRKMEVDESYSEAFTLGVPHGAIPGSERATASIIGDVMGPTLNHLNNLLRL
PFGCGEQNMIHFAPNVFVLKYLQKTQQLSPEVERETTDYLVQGYQRQLTYKRQDGSYSAF
GERDASGSMWLTAFVLKSFAQARSFIFVDPRELAAAKSWIIQQQQADGSFLAVGRVLNKD
IQGGIHGTVPLTAYVVVALLETGTASEEERGSTDKARHFLESAAPLAMDPYSCALTTYAL
TLLRSPAAPEALRKLRSLAIMRDGVTHWSLSNSWDVDKGTFLSFSDRVSQSVVSAEVEMT
AYALLTYTLLGDVAAALPVVKWLSQQRNALGGFSSTQDTCVALQALAEYAILSYAGGINL
TVSLASTNLDYQETFELHRTNQKVLQTAAIPSLPTGLFVSAKGDGCCLMQIDVTYNVPDP
VAKPAFQLLVSLQEPEAQGRPPPMPASAAEGSRGDWPPADDDDPAADQHHQEYKVMLEVC
TRWLHAGSSNMAVLEVPLLSGFRADIESLEQLLLDKHMGMKRYEVAGRRVLFYFDEIPSR
CLTCVRFRALRECVVGRTSALPVSVYDYYEPAFEATRFYNVSTHSPLARELCAGPACNEV
ERAPARGPGWFPGESGPAVAPEEGAAIARCGCDHDCGAQGNPVCGSDGVVYASACRLREA
ACRQAAPLEPAPPSCCALEQRLPASSSSTYGDDLASVAPGPLQQDVKLNGAGLEVEDSDP
EPEGEAEDRVTAGPRPPVSSGNLESSTQSASPFHRWGQTPAPQRHSGRVVGAHRPGLLSP
VFVYSPAFQSGGEEGLWMSNTCTLR
NT seq 5658 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcgccctgctctggccgttgctcccgctcctgctcctgctgctgtcggcgcgg
gacggcgtgcgcgccgcgcagcctcaggccccgggttacttgattgcagctccctctgtt
tttcgcgcgggcgtggaggaagtcatcagcgtgaccatctttaactctccaagggaagtc
acggtccaggctcagctggtggcccagggtgagccggtggtgcagagccagggagccatc
ctggataaagggacaatcaaactcaaggtgcccacgggcctccggggccaagcgcttctg
aaagtgtggggccgcggctggcaggcggaggaggggcccctctttcacaaccagacctcg
gtgaccgtggacggccggggcgcttctgtattcatccagacggacaagcctgtgtacaga
ccccagcaccgagtgctcataagcatcttcaccgtctctccaaatctgaggcctgtcaac
gagaagctggaagcctacatcctggacccccgaggctctcggatgatagagtggagacac
ttaaagccgttctgctgcggcatcaccaacatgagcttccccttgtccgaccagcctgtg
ttgggagaatggttcatttttgttgaaatgcaaggccacgcgtacaacaagtcttttgaa
gttcagaagtatgtgttgcccaagtttgagcttctgattgacccgccccggtatatccaa
gacctggacgcctgtgagacaggcactgtgcgggccaggtatacctttgggaaacctgtg
gctggtgccttaatgatcaacatgactgttaatggtgtagggtactacagccacgaggtg
ggacgccctgtcctcagaacaaccaagatcctcggctcccgggacttcgacatctgcgtg
agggacatgatcccagcggacgtccctgagcacttccggggcagggtcagcatctgggcc
atggtgaccagtgtggacgggagccagcaggtcgcgttcgatgactccacccccgtgcag
aggcagctggtggacatccggtactccaaggacacgaggaagcagttcaagccgggcctg
gcctacgtggggaaggtggagctatcctaccccgatggcagcccagctgagggggtgacg
gtccagattaaggcagagctgacaccaaaggataacatctacaccagtgaagttgtgtcc
cagcgtggactagtggggtttgaaatcccctccatccccacgtcagcccagcacgtgtgg
ctggagaccaaggtgatggcactgaacgggaagcctgtgggggctcagtacctgcccagc
tacctctccctcggcagctggtactcccccagccagtgctacctgcagctgcagccaccc
tcccacccactgcaggttggggaagaagcctatttttctgtgaagtccacatgtccctgc
aactttaccctgtactacgaggtggctgcacggggcaatattgtgctatcgggccagcag
cctgcccacaccacccagcagcgaagcaagcgggcggcccctgccctggagaaaccgatt
cgtttaacacacctttctgagacagagcccccaccagccccagaagctgaggtcgacgtg
tgtgtgacctctcttcatctggccgtgacccccagcatggtcccccttggtcgcctgctg
gtcttctacgtcagggagaatggagaaggggtcgccgacagccttcagtttgcagtcgag
accttcttcgaaaaccaggtttcagtgacgtattcagcaaatgagacccaacctggggag
gttgtcgacctgcggatcagggctgcaaggggcagctgtgtgtgcgtcgccgcagttgat
aagagtgtctacctgctcaggtctgggttccggctgactcctgcccaggttttccaggaa
ctggaagattatgatgtttctgattcctttggcgtgtccagggaggatggtcctttttgg
tgggctgggctgacggcacaacgacgccggcgctcctctgtcttcccgtggccttggggc
atcaccaaggactctgggtttgccttcaccgaaacgggactggtggtgatgaccgaccga
gtgagcctgaaccaccggcaggacggtggcctctacaccgatgaggctgtccccgctttc
cagccccacacagggagcctggtggcagtggctccttccaggcacccccccagaacagag
aagagaaaaaggactttcttccccgaaacatggatttggcattgtctcaacatcagtgac
ccatctggtgaggggacactcagtgtgaaggtcccggactccatcaccagctgggtgggt
gaggccgtggccctgtccacctctcagggcttaggcatcgccgagccctccctgctgaag
accttcaagcccttcttcgtggacttcatgctccccgctctcatcatccgtggggagcag
gtcaagatcccgctcagtgtctacaactacatgggcacctgcgctgaggtgtacatgaag
ctctcggttcccaagggcatccagtttgttgggcatcctggcaaacgccatgtgaccaag
aagatgtgtgtggcccccggggaggctgagcccatctgggtcgttctgtccttcagcgac
ctgggactcaacaacatcacggccaaagcccttgcttacggagacacaaattgctgccgg
gatgggaggtccagcaaacaccctgaggagaatcacgccgacaggagggtccccatcggg
gtggatcacgtcaggcgcagtgtgatggttgaggcggaaggagtcccccgggcgtacacc
tacagcgcattcttctgtcccagtgagagagtccacatctccacccccaacaagtatgag
ttccagtatgtgcagcggccactgcgcctcacccgctttgatgtggctgtgcgagctcac
aatgatgcccgtgtggccttgtcttctgggccccaggacacagcaggcatgatcgagatc
gtcctgggggggcatcagaacaccaggtcatggatctccaccagcaagatgggagagccc
gtggccagtgcacacacggccaagatcctctcctgggatgaattcagaacattctggatc
agctggcgtggtggccttatccaggttggccatggtccagagccatccaatgagtctgtc
attgtggcctggaccctcccgaggccaccagaggtccagttcattggcttttccaccggc
tggggctccatgggtgaattccgaatctggaggaagatggaggtggacgagagctacagc
gaggccttcaccctgggggtcccacacggcgccatccctgggtctgagcgagccaccgcc
tccatcatcggggacgtcatggggccaaccctgaaccacctcaacaacctcctgcggctg
ccgtttggctgtggagagcagaacatgatccactttgcacccaacgtctttgtcttgaag
tatcttcagaaaacccagcagctcagccctgaggtggagagagagaccaccgactaccta
gtacaaggctaccagcgccagctgacctacaagcgccaggatggctcctacagcgcgttt
ggggagcgggacgcatcggggagcatgtggctcacagcctttgtcctgaagtccttcgca
caggctcgcagctttatcttcgtggacccccgggagctggctgccgccaagagctggatc
atccagcagcagcaggccgatggctccttcctggccgtgggcagggtcctgaacaaggac
atccagggtgggatccacggcactgtcccgctgacagcctacgtggtggttgctctcctg
gaaacaggcacagcctcagaggaggagagaggctccactgacaaagcgaggcacttcctg
gagtctgctgcgcccctggccatggacccttatagctgtgccctgactacctacgcgctg
accctgctccgcagcccggcagcccctgaggcactgcgcaagctccgtagcctggccatc
atgcgagatggggtcacccactggagcctgtcaaattcctgggacgtggacaagggcaca
ttcttgagcttcagtgacagggtctctcagtcagtggtctcggccgaggtggaaatgaca
gcctacgcccttctgacctacactctgctgggtgacgtggctgccgccctgcctgtggtg
aagtggctgtcccagcagcgaaatgcacttgggggcttctcctccactcaggacacctgc
gtggctctgcaggccttggctgaatatgccatcttgtcctatgctggaggcatcaacctc
actgtctccctggcctccaccaacctggactaccaggaaaccttcgagctgcacaggacc
aaccagaaggttctgcagacagcagcgatccccagcctccccacggggctgtttgtgagt
gccaagggggacggctgctgcctgatgcagattgatgtcacctacaatgtgcctgacccg
gtggccaagccagctttccagctgctcgtaagcctccaggagcctgaggcccagggacgc
ccgccccccatgcctgcctccgcagctgagggttcccgaggagactggcccccagctgac
gatgatgacccagcggccgatcagcatcaccaggaatacaaggtgatgctggaggtgtgc
accaggtggctgcatgcagggtcttccaatatggctgtcctggaggtgcccctgctgtca
ggcttccgggcagacatcgagagcctggagcagctgctccttgacaagcacatggggatg
aagaggtatgaagtggctggacgccgagtgctcttctactttgatgagatccccagccgg
tgcctgacgtgcgtgcggttccgtgctctccgggagtgcgtggtgggcaggacgtcggcg
ctgccagtctccgtgtacgactactacgaacccgccttcgaggccactcgcttctacaac
gtcagcacccacagcccactcgcccgggaactgtgcgccggacccgcgtgcaacgaagtg
gagcgcgcccctgcccggggcccgggctggttccccggcgagtcgggccctgccgtggcc
cctgaggagggggcggcgatcgcgcgatgcggctgcgaccacgactgcggcgcccagggg
aacccggtgtgcggctccgacggggtggtctacgccagcgcctgccgcctgcgggaggcc
gcctgccgccaggccgcgcccctggagcccgcgcctcccagctgctgcgccctcgagcag
cggctgccggcctcgtcgtcctccacctacggggatgacctggcttctgtggccccgggg
cctttacagcaggacgtgaagctgaatggagccggccttgaggtggaggactcagaccct
gagcctgaaggggaggcggaggacagggtcacagccgggcctcggcctcctgtgagcagc
gggaacctggaaagcagcacccagagcgccagcccgttccacagatggggccagactccg
gcccctcagagacatagtggccgggtggtgggggcccacaggccagggcttctgagccct
gtcttcgtctacagcccagcctttcagagtggtggggaggagggtttatggatgtcaaac
acctgcaccttgagataa

DBGET integrated database retrieval system