KEGG   Homo sapiens (human): 27250
Entry
27250             CDS       T01001                                 

Gene name
PDCD4, H731
Definition
(RefSeq) programmed cell death 4
  KO
K16865  programmed cell death protein 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa05205  Proteoglycans in cancer
hsa05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    27250 (PDCD4)
   05205 Proteoglycans in cancer
    27250 (PDCD4)
SSDB
Motif
Pfam: MA3 Adhes-Ig_like
Other DBs
NCBI-GeneID: 27250
NCBI-ProteinID: NP_055271
OMIM: 608610
HGNC: 8763
Ensembl: ENSG00000150593
Vega: OTTHUMG00000019048
Pharos: Q53EL6(Tchem)
UniProt: Q53EL6
LinkDB
Structure
PDB: 
2RG8 2ZU6 3EIJ 2KZT 2GGF

Position
10q25.2
AA seq 469 aa
MDVENEQILNVNPADPDNLSDSLFSGDEENAGTEEIKNEINGNWISASSINEARINAKAK
RRLRKNSSRDSGRGDSVSDSGSDALRSGLTVPTSPKGRLLDRRSRSGKGRGLPKKGGAGG
KGVWGTPGQVYDVEEVDVKDPNYDDDQENCVYETVVLPLDERAFEKTLTPIIQEYFEHGD
TNEVAEMLRDLNLGEMKSGVPVLAVSLALEGKASHREMTSKLLSDLCGTVMSTTDVEKSF
DKLLKDLPELALDTPRAPQLVGQFIARAVGDGILCNTYIDSYKGTVDCVQARAALDKATV
LLSMSKGGKRKDSVWGSGGGQQSVNHLVKEIDMLLKEYLLSGDISEAEHCLKELEVPHFH
HELVYEAIIMVLESTGESTFKMILDLLKSLWKSSTITVDQMKRGYERIYNEIPDINLDVP
HSYSVLERFVEECFQAGIISKQLRDLCPSRGRKRFVSEGDGGRLKPESY
NT seq 1410 nt   +upstreamnt  +downstreamnt
atggatgtagaaaatgagcagatactgaatgtaaaccctgcagatcctgataacttaagt
gactctctcttttccggtgatgaagaaaatgctgggactgaggaaataaagaatgaaata
aatggaaattggatttcagcatcctccattaacgaagctagaattaatgccaaggcaaaa
aggcgactaaggaaaaactcatcccgggactctggcagaggcgattcggtcagcgacagt
gggagtgacgcccttagaagtggattaactgtgccaaccagtccaaagggaaggttgctg
gataggcgatccagatctgggaaaggaaggggactaccaaagaaaggtggtgcaggaggc
aaaggtgtctggggtacacctggacaggtgtatgatgtggaggaggtggatgtgaaagat
cctaactatgatgatgaccaggagaactgtgtttatgaaactgtagttttgcctttggat
gaaagggcatttgagaagactttaacaccaatcatacaggaatattttgagcatggagat
actaatgaagttgcggaaatgttaagagatttaaatcttggtgaaatgaaaagtggagta
ccagtgttggcagtatccttagcattggaggggaaggctagtcatagagagatgacatct
aagcttctttctgacctttgtgggacagtaatgagcacaactgatgtggaaaaatcattt
gataaattgttgaaagatctacctgaattagcactggatactcctagagcaccacagttg
gtgggccagtttattgctagagctgttggagatggaattttatgtaatacctatattgat
agttacaaaggaactgtagattgtgtgcaggctagagctgctctggataaggctaccgtg
cttctgagtatgtctaaaggtggaaagcgtaaagatagtgtgtggggctctggaggtggg
cagcaatctgtcaatcaccttgttaaagagattgatatgctgctgaaagaatatttactc
tctggagacatatctgaagctgaacattgccttaaggaactggaagtacctcattttcac
catgagcttgtatatgaagctattataatggttttagagtcaactggagaaagtacattt
aagatgattttggatttattaaagtccctttggaagtcttctaccattactgtagaccaa
atgaaaagaggttatgagagaatttacaatgaaattccggacattaatctggatgtccca
cattcatactctgtgctggagcggtttgtagaagaatgttttcaggctggaataatttcc
aaacaactcagagatctttgtccttcaaggggcagaaagcgttttgtaagcgaaggagat
ggaggtcgtcttaaaccagagagctactga

DBGET integrated database retrieval system