KEGG   Homo sapiens (human): 27302Help
Entry
27302             CDS       T01001                                 

Gene name
BMP10
Definition
(RefSeq) bone morphogenetic protein 10
  KO
K22670  bone morphogenetic protein 10
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    27302 (BMP10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    27302 (BMP10)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   27302 (BMP10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TGF_beta TGFb_propeptide
Motif
Other DBs
NCBI-GeneID: 27302
NCBI-ProteinID: NP_055297
OMIM: 608748
HGNC: 20869
Ensembl: ENSG00000163217
Vega: OTTHUMG00000129573
Pharos: O95393(Tbio)
UniProt: O95393
LinkDB All DBs
Position
2p13.3
AA seq 424 aa AA seqDB search
MGSLVLTLCALFCLAAYLVSGSPIMNLEQSPLEEDMSLFGDVFSEQDGVDFNTLLQSMKD
EFLKTLNLSDIPTQDSAKVDPPEYMLELYNKFATDRTSMPSANIIRSFKNEDLFSQPVSF
NGLRKYPLLFNVSIPHHEEVIMAELRLYTLVQRDRMIYDGVDRKITIFEVLESKGDNEGE
RNMLVLVSGEIYGTNSEWETFDVTDAIRRWQKSGSSTHQLEVHIESKHDEAEDASSGRLE
IDTSAQNKHNPLLIVFSDDQSSDKERKEELNEMISHEQLPELDNLGLDSFSSGPGEEALL
QMRSNIIYDSTARIRRNAKGNYCKRTPLYIDFKEIGWDSWIIAPPGYEAYECRGVCNYPL
AEHLTPTKHAIIQALVHLKNSQKASKACCVPTKLEPISILYLDKGVVTYKFKYEGMAVSE
CGCR
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgggctctctggtcctgacactgtgcgctcttttctgcctggcagcttacttggtttct
ggcagccccatcatgaacctagagcagtctcctctggaagaagatatgtccctctttggt
gatgttttctcagagcaagacggtgtcgactttaacacactgctccagagcatgaaggat
gagtttcttaagacactaaacctctctgacatccccacgcaggattcagccaaggtggac
ccaccagagtacatgttggaactctacaacaaatttgcaacagatcggacctccatgccc
tctgccaacatcattaggagtttcaagaatgaagatctgttttcccagccggtcagtttt
aatgggctccgaaaataccccctcctcttcaatgtgtccattcctcaccatgaagaggtc
atcatggctgaacttaggctatacacactggtgcaaagggatcgtatgatatacgatgga
gtagaccggaaaattaccatttttgaagtgctggagagcaaaggggataatgagggagaa
agaaacatgctggtcttggtgtctggggagatatatggaaccaacagtgagtgggagact
tttgatgtcacagatgccatcagacgttggcaaaagtcaggctcatccacccaccagctg
gaggtccacattgagagcaaacacgatgaagctgaggatgccagcagtggacggctagaa
atagataccagtgcccagaataagcataaccctttgctcatcgtgttttctgatgaccaa
agcagtgacaaggagaggaaggaggaactgaatgaaatgatttcccatgagcaacttcca
gagctggacaacttgggcctggatagcttttccagtggacctggggaagaggctttgttg
cagatgagatcaaacatcatctatgactccactgcccgaatcagaaggaacgccaaagga
aactactgtaagaggaccccgctctacatcgacttcaaggagattgggtgggactcctgg
atcatcgctccgcctggatacgaagcctatgaatgccgtggtgtttgtaactaccccctg
gcagagcatctcacacccacaaagcatgcaattatccaggccttggtccacctcaagaat
tcccagaaagcttccaaagcctgctgtgtgcccacaaagctagagcccatctccatcctc
tatttagacaaaggcgtcgtcacctacaagtttaaatacgaaggcatggccgtctccgaa
tgtggctgtagatag

DBGET integrated database retrieval system