KEGG   Homo sapiens (human): 2735Help
Entry
2735              CDS       T01001                                 

Gene name
GLI1, GLI, PAPA8, PPD1
Definition
(RefSeq) GLI family zinc finger 1
  KO
K16797  zinc finger protein GLI1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04024  cAMP signaling pathway
hsa04340  Hedgehog signaling pathway
hsa05200  Pathways in cancer
hsa05217  Basal cell carcinoma
Network
nt06217  HH signaling
nt06269  Basal cell carcinoma
  Element
N00010  Mutation-inactivated PTCH1 to Hedgehog signaling pathway
N00017  Mutation-activated SMO to Hedgehog signaling pathway
N00062  Hedgehog signaling pathway
Disease
H01852  Postaxial polydactyly
H02332  Preaxial polydactyly
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    2735 (GLI1)
   04024 cAMP signaling pathway
    2735 (GLI1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    2735 (GLI1)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    2735 (GLI1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    2735 (GLI1)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, GLI-like
    2735 (GLI1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C2H2 zf-H2C2_2 FOXP-CC zf-C2H2_4 IL17
Motif
Other DBs
NCBI-GeneID: 2735
NCBI-ProteinID: NP_005260
OMIM: 165220
HGNC: 4317
Ensembl: ENSG00000111087
Vega: OTTHUMG00000167332
Pharos: P08151(Tchem)
UniProt: P08151
LinkDB All DBs
Structure
PDB: 

Position
12q13.3
AA seq 1106 aa AA seqDB search
MFNSMTPPPISSYGEPCCLRPLPSQGAPSVGTEGLSGPPFCHQANLMSGPHSYGPARETN
SCTEGPLFSSPRSAVKLTKKRALSISPLSDASLDLQTVIRTSPSSLVAFINSRCTSPGGS
YGHLSIGTMSPSLGFPAQMNHQKGPSPSFGVQPCGPHDSARGGMIPHPQSRGPFPTCQLK
SELDMLVGKCREEPLEGDMSSPNSTGIQDPLLGMLDGREDLEREEKREPESVYETDCRWD
GCSQEFDSQEQLVHHINSEHIHGERKEFVCHWGGCSRELRPFKAQYMLVVHMRRHTGEKP
HKCTFEGCRKSYSRLENLKTHLRSHTGEKPYMCEHEGCSKAFSNASDRAKHQNRTHSNEK
PYVCKLPGCTKRYTDPSSLRKHVKTVHGPDAHVTKRHRGDGPLPRAPSISTVEPKREREG
GPIREESRLTVPEGAMKPQPSPGAQSSCSSDHSPAGSAANTDSGVEMTGNAGGSTEDLSS
LDEGPCIAGTGLSTLRRLENLRLDQLHQLRPIGTRGLKLPSLSHTGTTVSRRVGPPVSLE
RRSSSSSSISSAYTVSRRSSLASPFPPGSPPENGASSLPGLMPAQHYLLRARYASARGGG
TSPTAASSLDRIGGLPMPPWRSRAEYPGYNPNAGVTRRASDPAQAADRPAPARVQRFKSL
GCVHTPPTVAGGGQNFDPYLPTSVYSPQPPSITENAAMDARGLQEEPEVGTSMVGSGLNP
YMDFPPTDTLGYGGPEGAAAEPYGARGPGSLPLGPGPPTNYGPNPCPQQASYPDPTQETW
GEFPSHSGLYPGPKALGGTYSQCPRLEHYGQVQVKPEQGCPVGSDSTGLAPCLNAHPSEG
PPHPQPLFSHYPQPSPPQYLQSGPYTQPPPDYLPSEPRPCLDFDSPTHSTGQLKAQLVCN
YVQSQQELLWEGGGREDAPAQEPSYQSPKFLGGSQVSPSRAKAPVNTYGPGFGPNLPNHK
SGSYPTPSPCHENFVVGANRASHRAAAPPRLLPPLPTCYGPLKVGGTNPSCGHPEVGRLG
GGPALYPPPEGQVCNPLDSLDLDNTQLDFVAILDEPQGLSPPPSHDQRGSSGHTPPPSGP
PNMAVGNMSVLLRSLPGETEFLNSSA
NT seq 3321 nt NT seq  +upstreamnt  +downstreamnt
atgttcaactcgatgaccccaccaccaatcagtagctatggcgagccctgctgtctccgg
cccctccccagtcagggggcccccagtgtggggacagaaggactgtctggcccgcccttc
tgccaccaagctaacctcatgtccggcccccacagttatgggccagccagagagaccaac
agctgcaccgagggcccactcttttcttctccccggagtgcagtcaagttgaccaagaag
cgggcactgtccatctcacctctgtcggatgccagcctggacctgcagacggttatccgc
acctcacccagctccctcgtagctttcatcaactcgcgatgcacatctccaggaggctcc
tacggtcatctctccattggcaccatgagcccatctctgggattcccagcccagatgaat
caccaaaaagggccctcgccttcctttggggtccagccttgtggtccccatgactctgcc
cggggtgggatgatcccacatcctcagtcccggggacccttcccaacttgccagctgaag
tctgagctggacatgctggttggcaagtgccgggaggaacccttggaaggtgatatgtcc
agccccaactccacaggcatacaggatcccctgttggggatgctggatgggcgggaggac
ctcgagagagaggagaagcgtgagcctgaatctgtgtatgaaactgactgccgttgggat
ggctgcagccaggaatttgactcccaagagcagctggtgcaccacatcaacagcgagcac
atccacggggagcggaaggagttcgtgtgccactgggggggctgctccagggagctgagg
cccttcaaagcccagtacatgctggtggttcacatgcgcagacacactggcgagaagcca
cacaagtgcacgtttgaagggtgccggaagtcatactcacgcctcgaaaacctgaagacg
cacctgcggtcacacacgggtgagaagccatacatgtgtgagcacgagggctgcagtaaa
gccttcagcaatgccagtgaccgagccaagcaccagaatcggacccattccaatgagaag
ccgtatgtatgtaagctccctggctgcaccaaacgctatacagatcctagctcgctgcga
aaacatgtcaagacagtgcatggtcctgacgcccatgtgaccaaacggcaccgtggggat
ggccccctgcctcgggcaccatccatttctacagtggagcccaagagggagcgggaagga
ggtcccatcagggaggaaagcagactgactgtgccagagggtgccatgaagccacagcca
agccctggggcccagtcatcctgcagcagtgaccactccccggcagggagtgcagccaat
acagacagtggtgtggaaatgactggcaatgcagggggcagcactgaagacctctccagc
ttggacgagggaccttgcattgctggcactggtctgtccactcttcgccgccttgagaac
ctcaggctggaccagctacatcaactccggccaatagggacccggggtctcaaactgccc
agcttgtcccacaccggtaccactgtgtcccgccgcgtgggccccccagtctctcttgaa
cgccgcagcagcagctccagcagcatcagctctgcctatactgtcagccgccgctcctcc
ctggcctctcctttcccccctggctccccaccagagaatggagcatcctccctgcctggc
cttatgcctgcccagcactacctgcttcgggcaagatatgcttcagccagagggggtggt
acttcgcccactgcagcatccagcctggatcggataggtggtcttcccatgcctccttgg
agaagccgagccgagtatccaggatacaaccccaatgcaggggtcacccggagggccagt
gacccagcccaggctgctgaccgtcctgctccagctagagtccagaggttcaagagcctg
ggctgtgtccataccccacccactgtggcagggggaggacagaactttgatccttacctc
ccaacctctgtctactcaccacagccccccagcatcactgagaatgctgccatggatgct
agagggctacaggaagagccagaagttgggacctccatggtgggcagtggtctgaacccc
tatatggacttcccacctactgatactctgggatatgggggacctgaaggggcagcagct
gagccttatggagcgaggggtccaggctctctgcctcttgggcctggtccacccaccaac
tatggccccaacccctgtccccagcaggcctcatatcctgaccccacccaagaaacatgg
ggtgagttcccttcccactctgggctgtacccaggccccaaggctctaggtggaacctac
agccagtgtcctcgacttgaacattatggacaagtgcaagtcaagccagaacaggggtgc
ccagtggggtctgactccacaggactggcaccctgcctcaatgcccaccccagtgagggg
cccccacatccacagcctctcttttcccattacccccagccctctcctccccaatatctc
cagtcaggcccctatacccagccaccccctgattatcttccttcagaacccaggccttgc
ctggactttgattcccccacccattccacagggcagctcaaggctcagcttgtgtgtaat
tatgttcaatctcaacaggagctactgtgggagggtgggggcagggaagatgcccccgcc
caggaaccttcctaccagagtcccaagtttctggggggttcccaggttagcccaagccgt
gctaaagctccagtgaacacatatggacctggctttggacccaacttgcccaatcacaag
tcaggttcctatcccaccccttcaccatgccatgaaaattttgtagtgggggcaaatagg
gcttcacatagggcagcagcaccacctcgacttctgcccccattgcccacttgctatggg
cctctcaaagtgggaggcacaaaccccagctgtggtcatcctgaggtgggcaggctagga
gggggtcctgccttgtaccctcctcccgaaggacaggtatgtaaccccctggactctctt
gatcttgacaacactcagctggactttgtggctattctggatgagccccaggggctgagt
cctcctccttcccatgatcagcggggcagctctggacataccccacctccctctgggccc
cccaacatggctgtgggcaacatgagtgtcttactgagatccctacctggggaaacagaa
ttcctcaactctagtgcctaa

KEGG   Homo sapiens (human): 2736Help
Entry
2736              CDS       T01001                                 

Gene name
GLI2, CJS, HPE9, PHS2, THP1, THP2
Definition
(RefSeq) GLI family zinc finger 2
  KO
K16798  zinc finger protein GLI2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04340  Hedgehog signaling pathway
hsa04390  Hippo signaling pathway
hsa05200  Pathways in cancer
hsa05217  Basal cell carcinoma
Network
nt06217  HH signaling
nt06269  Basal cell carcinoma
  Element
N00010  Mutation-inactivated PTCH1 to Hedgehog signaling pathway
N00017  Mutation-activated SMO to Hedgehog signaling pathway
N00062  Hedgehog signaling pathway
Disease
H00267  Holoprosencephaly
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    2736 (GLI2)
   04390 Hippo signaling pathway
    2736 (GLI2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    2736 (GLI2)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    2736 (GLI2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    2736 (GLI2)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, GLI-like
    2736 (GLI2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 FOXP-CC
Motif
Other DBs
NCBI-GeneID: 2736
NCBI-ProteinID: NP_005261
OMIM: 165230
HGNC: 4318
Ensembl: ENSG00000074047
Vega: OTTHUMG00000153741
Pharos: P10070(Tchem)
UniProt: P10070 Q1PSW9 Q59FV5
LinkDB All DBs
Position
2q14.2
AA seq 1586 aa AA seqDB search
METSASATASEKQEAKSGILEAAGFPDPGKKASPLVVAAAAAAAVAAQGVPQHLLPPFHA
PLPIDMRHQEGRYHYEPHSVHGVHGPPALSGSPVISDISLIRLSPHPAGPGESPFNAPHP
YVNPHMEHYLRSVHSSPTLSMISAARGLSPADVAQEHLKERGLFGLPAPGTTPSDYYHQM
TLVAGHPAPYGDLLMQSGGAASAPHLHDYLNPVDVSRFSSPRVTPRLSRKRALSISPLSD
ASLDLQRMIRTSPNSLVAYINNSRSSSAASGSYGHLSAGALSPAFTFPHPINPVAYQQIL
SQQRGLGSAFGHTPPLIQPSPTFLAQQPMALTSINATPTQLSSSSNCLSDTNQNKQSSES
AVSSTVNPVAIHKRSKVKTEPEGLRPASPLALTQGQVSGHGSCGCALPLSQEQLADLKED
LDRDDCKQEAEVVIYETNCHWEDCTKEYDTQEQLVHHINNEHIHGEKKEFVCRWQACTRE
QKPFKAQYMLVVHMRRHTGEKPHKCTFEGCSKAYSRLENLKTHLRSHTGEKPYVCEHEGC
NKAFSNASDRAKHQNRTHSNEKPYICKIPGCTKRYTDPSSLRKHVKTVHGPDAHVTKKQR
NDVHLRTPLLKENGDSEAGTEPGGPESTEASSTSQAVEDCLHVRAIKTESSGLCQSSPGA
QSSCSSEPSPLGSAPNNDSGVEMPGTGPGSLGDLTALDDTPPGADTSALAAPSAGGLQLR
KHMTTMHRFEQLKKEKLKSLKDSCSWAGPTPHTRNTKLPPLPGSGSILENFSGSGGGGPA
GLLPNPRLSELSASEVTMLSQLQERRDSSTSTVSSAYTVSRRSSGISPYFSSRRSSEASP
LGAGRPHNASSADSYDPISTDASRRSSEASQCSGGSGLLNLTPAQQYSLRAKYAAATGGP
PPTPLPGLERMSLRTRLALLDAPERTLPAGCPRPLGPRRGSDGPTYGHGHAGAAPAFPHE
APGGGARRASDPVRRPDALSLPRVQRFHSTHNVNPGPLPPCADRRGLRLQSHPSTDGGLA
RGAYSPRPPSISENVAMEAVAAGVDGAGPEADLGLPEDDLVLPDDVVQYIKAHASGALDE
GTGQVYPTESTGFSDNPRLPSPGLHGQRRMVAADSNVGPSAPMLGGCQLGFGAPSSLNKN
NMPVQWNEVSSGTVDALASQVKPPPFPQGNLAVVQQKPAFGQYPGYSPQGLQASPGGLDS
TQPHLQPRSGAPSQGIPRVNYMQQLRQPVAGSQCPGMTTTMSPHACYGQVHPQLSPSTIS
GALNQFPQSCSNMPAKPGHLGHPQQTEVAPDPTTMGNRHRELGVPDSALAGVPPPHPVQS
YPQQSHHLAASMSQEGYHQVPSLLPARQPGFMEPQTGPMGVATAGFGLVQPRPPLEPSPT
GRHRGVRAVQQQLAYARATGHAMAAMPSSQETAEAVPKGAMGNMGSVPPQPPPQDAGGAP
DHSMLYYYGQIHMYEQDGGLENLGSCQVMRSQPPQPQACQDSIQPQPLPSPGVNQVSSTV
DSQLLEAPQIDFDAIMDDGDHSSLFSGALSPSLLHSLSQNSSRLTTPRNSLTLPSIPAGI
SNMAVGDMSSMLTSLAEESKFLNMMT
NT seq 4761 nt NT seq  +upstreamnt  +downstreamnt
atggagacgtctgcctcagccactgcctccgagaagcaagaagccaaaagtgggatcctg
gaggccgctggcttccccgacccgggtaaaaaggcctctcctttggtggtggctgcagcg
gcagcagcagcggtagctgcccaaggagtgccgcagcatctcttgccaccattccatgcg
cccctaccgattgacatgcgacaccaggaaggaaggtaccattacgagcctcattctgtc
cacggtgtgcacgggccccctgccctcagcggcagccctgtcatctctgacatctccttg
atccggctttccccgcacccggctggccctggggagtcccccttcaacgccccccacccg
tacgtgaacccccacatggagcactacctccgttctgtgcacagcagccccacgctctcc
atgatctctgcagccaggggcctcagccccgctgatgtggcccaggagcaccttaaggag
aggggactgtttggccttcctgctccaggcaccaccccctcagactattaccaccagatg
accctcgtggcaggccaccccgcgccctacggggacctgctgatgcagagcgggggcgct
gccagcgcaccccatctccacgactacctcaaccccgtggacgtgtcccgtttctccagc
ccgcgggtgacgccccgcctgagccgcaagcgggcgctgtccatctccccactctcagac
gccagcctggacctgcagcggatgatccgcacctcacccaactcgctagtggcctacatc
aacaactcccgaagcagctcggcggccagcggttcctacgggcatctgtcagcgggtgcc
ctcagcccagccttcaccttcccccaccccatcaaccccgtggcctaccagcagattctg
agccagcagaggggtctggggtcagcctttggacacacaccacccctgatccagccctca
cccaccttcctggcccagcagcccatggccctcacctccatcaatgccacgcccacccag
ctcagcagcagcagcaactgtctgagtgacaccaaccagaacaagcagagcagtgagtcg
gccgtcagcagcaccgtcaaccctgtcgccattcacaagcgcagcaaggtcaagaccgag
cctgagggcctgcggccggcctcccctctggcgctgacgcagggccaggtgtctggacac
ggctcatgtgggtgtgcccttcccctctcccaggagcagctggctgacctcaaggaagat
ctggacagggatgactgtaagcaggaggctgaggtggtcatctatgagaccaactgccac
tgggaagactgcaccaaggagtacgacacccaggagcagctggtgcatcacatcaacaac
gagcacatccacggggagaagaaggagtttgtgtgccgctggcaggcctgcacgcgggag
cagaagcccttcaaggcgcagtacatgctggtggtgcacatgcggcgacacacgggcgag
aagccccacaagtgcacgttcgagggctgctcgaaggcctactcccgcctggagaacctg
aagacacacctgcggtcccacaccggggagaagccatatgtgtgtgagcacgagggctgc
aacaaagccttctccaacgcctcggaccgcgccaagcaccagaatcgcacccactccaac
gagaaaccctacatctgcaagatcccaggctgcaccaagagatacacagaccccagctct
ctccggaagcatgtgaaaacggtccacggcccagatgcccacgtcaccaagaagcagcgc
aatgacgtgcacctccgcacaccgctgctcaaagagaatggggacagtgaggccggcacg
gagcctggcggcccagagagcaccgaggccagcagcaccagccaggccgtggaggactgc
ctgcacgtcagagccatcaagaccgagagctccgggctgtgtcagtccagccccggggcc
cagtcgtcctgcagcagcgagccctctcctctgggcagtgcccccaacaatgacagtggc
gtggagatgccggggacggggcccgggagcctgggagacctgacggcactggatgacaca
cccccaggggccgacacctcagccctggctgccccctccgctggtggcctccagctgcgc
aaacacatgaccaccatgcaccggttcgagcagctcaagaaggagaagctcaagtcactc
aaggattcctgctcatgggccgggccgactccacacacgcggaacaccaagctgcctccc
ctcccgggaagtggctccatcctggaaaacttcagtggcagtgggggcggcgggcccgcg
gggctgctgccgaacccgcggctgtcggagctgtccgcgagcgaggtgaccatgctgagc
cagctgcaggagcgccgcgacagctccaccagcacggtcagctcggcctacaccgtgagc
cgccgctcctccggcatctccccctacttctccagccgccgctccagcgaggcctcgccc
ctgggcgccggccgcccgcacaacgcgagctccgctgactcctacgaccccatctccacg
gacgcgtcgcggcgctcgagcgaggccagccagtgcagcggcggctccgggctgctcaac
ctcacgccggcgcagcagtacagcctgcgggccaagtacgcggcagccactggcggcccc
ccgcccactccgctgccgggcctggagcgcatgagcctgcggaccaggctggcgctgctg
gacgcgcccgagcgcacgctgcccgccggctgcccacgcccactggggccgcggcgtggc
agcgacgggccgacctatggccacggccacgcgggggctgcgcccgccttcccccacgag
gctccaggcggcggagccaggcgggccagcgaccctgtgcggcggcccgatgccctgtcc
ctgccgcgggtgcagcgcttccacagcacccacaacgtgaaccccggcccgctgccgccc
tgtgccgacaggcgaggcctccgcctgcagagccacccgagcaccgacggcggcctggcc
cgcggcgcctactcgccccggccgcctagcatcagcgagaacgtggcgatggaggccgtg
gcggcaggagtggacggcgcggggcccgaggccgacctggggctgccggaggacgacctg
gtgcttccagacgacgtggtgcagtacatcaaggcgcacgccagtggcgctctggacgag
ggcaccgggcaggtgtatcccacggaaagcactggcttctctgacaaccccagactaccc
agcccggggctgcacggccagcgcaggatggtggctgcggactccaacgtgggcccctcc
gcccctatgctgggaggatgccagttaggctttggggcgccctccagcctgaacaaaaat
aacatgcctgtgcagtggaatgaggtgagctccggcaccgtagacgccctggccagccag
gtgaagcctccaccctttcctcagggcaacctggcggtggtgcagcagaagcctgccttt
ggccagtacccgggctacagtccgcaaggcctacaggctagccctgggggcctggacagc
acgcagccacacctgcagccccgcagcggagccccctcccagggcatccccagggtaaac
tacatgcagcagctgcgacagccagtggcaggcagccagtgtcctggcatgactaccact
atgagcccccatgcctgctatggccaagtccacccccagctgagccccagcaccatcagt
ggggccctcaaccagttcccccaatcctgcagcaacatgccagccaagccagggcatctg
gggcaccctcagcagacagaagtggcacctgaccccaccacgatgggcaatcgccacagg
gaacttggggtccccgattcagccctggctggagtgccaccacctcacccagtccagagc
tacccacagcagagccatcacctggcagcctccatgagccaggagggctaccaccaggtc
cccagccttctgcctgcccgccagcctggcttcatggagccccaaacaggcccgatgggg
gtggctacagcaggctttggcctagtgcagccccggcctcccctcgagcccagccccact
ggccgccaccgtggggtacgtgctgtgcagcagcagctggcctacgccagggccacaggc
catgccatggctgccatgccgtccagtcaggaaacagcagaggctgtgcccaagggagcg
atgggcaacatggggtcggtgcctccccagccgcctccgcaggacgcaggtggggccccg
gaccacagcatgctctactactacggccagatccacatgtacgaacaggatggaggcctg
gagaacctcgggagctgccaggtcatgcggtcccagccaccacagccacaggcctgtcag
gacagcatccagccccagcccttgccctcaccaggggtcaaccaggtgtccagcactgtg
gactcccagctcctggaggccccccagattgacttcgatgccatcatggatgatggcgat
cactcgagtttgttctcgggtgctctgagccccagcctcctccacagcctctcccagaac
tcctcccgcctcaccaccccccgaaactccttgaccctgccctccatccccgcaggcatc
agcaacatggctgtcggggacatgagctccatgctcaccagcctcgccgaggagagcaag
ttcctgaacatgatgacctag

KEGG   Homo sapiens (human): 2737Help
Entry
2737              CDS       T01001                                 

Gene name
GLI3, ACLS, GCPS, GLI3-190, GLI3FL, PAP-A, PAPA, PAPA1, PAPB, PHS, PPDIV
Definition
(RefSeq) GLI family zinc finger 3
  KO
K06230  zinc finger protein GLI3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04024  cAMP signaling pathway
hsa04340  Hedgehog signaling pathway
hsa05200  Pathways in cancer
hsa05217  Basal cell carcinoma
Network
nt06217  HH signaling
nt06269  Basal cell carcinoma
  Element
N00010  Mutation-inactivated PTCH1 to Hedgehog signaling pathway
N00017  Mutation-activated SMO to Hedgehog signaling pathway
N00062  Hedgehog signaling pathway
Disease
H00502  Pallister-Hall syndrome
H01226  Polysyndactyly
H01852  Postaxial polydactyly
H02161  Greig cephalopolysyndactyly syndrome
H02332  Preaxial polydactyly
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    2737 (GLI3)
   04024 cAMP signaling pathway
    2737 (GLI3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    2737 (GLI3)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    2737 (GLI3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    2737 (GLI3)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, GLI-like
    2737 (GLI3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 FOXP-CC IL17
Motif
Other DBs
NCBI-GeneID: 2737
NCBI-ProteinID: NP_000159
OMIM: 165240
HGNC: 4319
Ensembl: ENSG00000106571
Vega: OTTHUMG00000023630
Pharos: P10071(Tbio)
UniProt: P10071
LinkDB All DBs
Position
7p14.1
AA seq 1580 aa AA seqDB search
MEAQSHSSTTTEKKKVENSIVKCSTRTDVSEKAVASSTTSNEDESPGQTYHRERRNAITM
QPQNVQGLSKVSEEPSTSSDERASLIKKEIHGSLPHVAEPSVPYRGTVFAMDPRNGYMEP
HYHPPHLFPAFHPPVPIDARHHEGRYHYDPSPIPPLHMTSALSSSPTYPDLPFIRISPHR
NPTAASESPFSPPHPYINPYMDYIRSLHSSPSLSMISATRGLSPTDAPHAGVSPAEYYHQ
MALLTGQRSPYADIIPSAATAGTGAIHMEYLHAMDSTRFSSPRLSARPSRKRTLSISPLS
DHSFDLQTMIRTSPNSLVTILNNSRSSSSASGSYGHLSASAISPALSFTYSSAPVSLHMH
QQILSRQQSLGSAFGHSPPLIHPAPTFPTQRPIPGIPTVLNPVQVSSGPSESSQNKPTSE
SAVSSTGDPMHNKRSKIKPDEDLPSPGARGQQEQPEGTTLVKEEGDKDESKQEPEVIYET
NCHWEGCAREFDTQEQLVHHINNDHIHGEKKEFVCRWLDCSREQKPFKAQYMLVVHMRRH
TGEKPHKCTFEGCTKAYSRLENLKTHLRSHTGEKPYVCEHEGCNKAFSNASDRAKHQNRT
HSNEKPYVCKIPGCTKRYTDPSSLRKHVKTVHGPEAHVTKKQRGDIHPRPPPPRDSGSHS
QSRSPGRPTQGALGEQQDLSNTTSKREECLQVKTVKAEKPMTSQPSPGGQSSCSSQQSPI
SNYSNSGLELPLTDGGSIGDLSAIDETPIMDSTISTATTALALQARRNPAGTKWMEHVKL
ERLKQVNGMFPRLNPILPPKAPAVSPLIGNGTQSNNTCSLGGPMTLLPGRSDLSGVDVTM
LNMLNRRDSSASTISSAYLSSRRSSGISPCFSSRRSSEASQAEGRPQNVSVADSYDPIST
DASRRSSEASQSDGLPSLLSLTPAQQYRLKAKYAAATGGPPPTPLPNMERMSLKTRLALL
GDALEPGVALPPVHAPRRCSDGGAHGYGRRHLQPHDAPGHGVRRASDPVRTGSEGLALPR
VPRFSSLSSCNPPAMATSAEKRSLVLQNYTRPEGGQSRNFHSSPCPPSITENVTLESLTM
DADANLNDEDFLPDDVVQYLNSQNQAGYEQHFPSALPDDSKVPHGPGDFDAPGLPDSHAG
QQFHALEQPCPEGSKTDLPIQWNEVSSGSADLSSSKLKCGPRPAVPQTRAFGFCNGMVVH
PQNPLRSGPAGGYQTLGENSNPYGGPEHLMLHNSPGSGTSGNAFHEQPCKAPQYGNCLNR
QPVAPGALDGACGAGIQASKLKSTPMQGSGGQLNFGLPVAPNESAGSMVNGMQNQDPVGQ
GYLAHQLLGDSMQHPGAGRPGQQMLGQISATSHINIYQGPESCLPGAHGMGSQPSSLAVV
RGYQPCASFGGSRRQAMPRDSLALQSGQLSDTSQTCRVNGIKMEMKGQPHPLCSNLQNYS
GQFYDQTVGFSQQDTKAGSFSISDASCLLQGTSAKNSELLSPGANQVTSTVDSLDSHDLE
GVQIDFDAIIDDGDHSSLMSGALSPSIIQNLSHSSSRLTTPRASLPFPALSMSTTNMAIG
DMSSLLTSLAEESKFLAVMQ
NT seq 4743 nt NT seq  +upstreamnt  +downstreamnt
atggaggcccagtcccacagctccacgaccactgaaaagaaaaaagttgagaattccata
gtgaagtgctccactcgaacagatgtgagcgagaaagccgttgcctccagcaccacttct
aatgaggatgaaagtcctggacagacttatcacagagagagaagaaacgcaatcactatg
cagccacagaatgtccaggggctcagcaaagtcagtgaggaaccttcaacatcgagtgac
gagagggcctcattgatcaagaaagagatccatgggtccctgccacacgtggcggagccc
tctgtgccgtaccgcgggacggtgtttgccatggaccccaggaatggttacatggagccc
cactaccaccctcctcatcttttccctgccttccatcctcctgtaccaattgatgccaga
catcatgagggccgttaccattacgatccatctccgattcctccattgcatatgacttcc
gccttatctagtagccctacgtatccggacctgcccttcattaggatctccccacaccgg
aaccccactgctgcttccgagtctcccttcagccctccacatccctacattaatccctac
atggactatatccgctccttgcacagcagcccatcgctctccatgatctcagcaacccgt
gggctgagccctacagatgcgccccatgcaggagtcagcccagcagaatactatcatcag
atggccctgctaactggccagcgcagcccctatgcagacattattccctcagctgccacc
gccggcacgggggccatccacatggaatatcttcatgctatggatagcaccagattctcc
agccccaggctgtcagccaggccgagccgaaaacgtacactgtccatatcaccactctcc
gatcatagctttgaccttcagaccatgataaggacgtctcccaactccttggtcacgatt
ctcaataattcccgtagcagctcttcagcaagtggctcctatggtcacttatctgcaagt
gcaatcagccctgccttgagcttcacctactcttccgcgcccgtctctctccacatgcat
cagcagatcctaagccgacaacagagcttaggttcagcctttggacacagccctccactc
atccaccctgccccaacttttccaacacagaggcctattccagggatccctacggttctg
aaccccgtccaggtcagctccggcccttctgagtcctcacagaacaagcccacgagtgag
tctgcagtgagcagcactggtgacccgatgcacaacaagaggtccaagatcaaacccgat
gaagacctccccagcccaggggctcgggggcagcaggaacagcccgaaggaacaaccctt
gtcaaggaggaaggggacaaagatgaaagcaaacaggagcctgaagtcatctatgagaca
aactgccactgggaaggctgcgcgagggagttcgacacccaagagcagcttgtgcaccat
ataaataacgaccatattcatggagagaagaaggagttcgtgtgcaggtggctggactgc
tcaagagagcagaaacccttcaaagcccagtatatgttggtagtgcatatgagaagacac
acgggcgagaagcctcacaaatgcacttttgaaggttgcacaaaggcctactcgagacta
gaaaacttgaaaacacacttgagatctcacactggagagaaaccatacgtctgtgagcac
gaaggttgcaacaaggctttctcaaatgcctctgatcgcgccaaacaccaaaacagaacg
cattccaatgagaaaccatatgtgtgcaaaatcccaggctgcactaagcgttacacagac
ccaagctccctccggaaacatgtgaagacagtgcatggcccagaggctcatgtcaccaag
aagcagcgaggggacatccatcctcggccgccacccccgagagattccggcagccattca
cagtccaggtcgcctggccgaccgactcagggagcccttggtgagcagcaggacctcagc
aacactacctcaaagcgggaagaatgcctccaggtgaaaaccgtcaaggcagagaagcca
atgacatctcagccaagccctggtggtcagtcttcatgcagcagccaacagtcccccatc
agcaactattccaacagtgggctcgagcttcctctgaccgatggaggtagtataggagac
ctcagtgccatcgatgaaaccccaatcatggactcaaccatttccactgcaaccacagcc
cttgctttgcaagccaggagaaacccggcagggaccaaatggatggagcacgtaaaacta
gaaaggctaaaacaagtgaatggaatgtttccgcgactgaaccccattctaccccctaaa
gcccctgcggtctctcctctcataggaaatggcacacagtccaacaacacctgcagcttg
ggtgggcccatgacgcttctcccgggcagaagcgacctctctggggtggacgtcactatg
ctgaacatgctcaacagaagggacagcagcgccagcaccatcagctcggcctacctgagc
agccgccgctcctcagggatctcgccctgcttctccagccgccgctccagcgaggcgtca
caggccgagggccggccgcagaacgtgagcgtggccgactcctacgaccccatctccacc
gacgcctcgcgccgctccagcgaagccagccagagcgacggcctgcccagcctgctcagc
ctcacgcccgcccagcagtaccgcctcaaggccaagtacgcggctgccacaggagggccg
ccgccgacgcccctgcccaacatggagaggatgagcctgaagacgcgcctggcgctgctc
ggggatgccctcgagcctggcgtggccctgcctccagttcatgccccgaggaggtgcagc
gacgggggagcccacggctacgggcggcgccacctgcagccgcacgatgcgccgggccac
ggcgtgaggagggccagcgacccggtgcggacaggctccgagggcctggccctgcctcgt
gtgccgcgcttcagcagcctcagcagctgcaaccccccggcgatggccacgtccgcggag
aagcgcagtctcgtgcttcagaattacacgcggcccgagggcggccagtcccgaaacttc
cactcgtccccctgtcctcccagcatcaccgagaacgtcaccctggagtccctgaccatg
gacgctgatgccaacctgaacgatgaggatttcctgccggacgacgtggtgcagtattta
aattcccagaaccaagcagggtacgagcagcacttccccagcgccctcccggacgacagc
aaagtgccccacgggcccggtgactttgacgcgcccgggctgccagacagccacgctggc
cagcagttccatgccctcgagcagccctgccccgagggcagcaaaaccgacctgcccatt
cagtggaacgaagtcagctccggaagcgccgacctgtcctcctccaagctcaagtgtggg
ccgcggcccgctgtgccgcagactcgcgcctttgggttctgcaacggcatggtcgtccac
ccgcagaaccccttgaggagcgggcctgctgggggctatcagaccctcggggagaacagc
aacccctacggtggcccagagcacttgatgctccacaacagccccggaagtggcaccagt
ggaaacgccttccatgaacagccctgtaaggccccgcagtatgggaactgtctcaacagg
cagccagtggcccctggtgcactcgacggtgcctgtggtgccgggattcaagcctcaaag
ctgaagagcacccccatgcaagggagcgggggccagctgaatttcggcctgccggtagcg
ccaaatgagtcagctggcagcatggtgaatggcatgcagaaccaggacccagtgggacag
gggtacctggctcaccagctcctcggcgacagcatgcagcacccgggggcaggccgcccc
ggtcagcagatgcttgggcagattagtgctacctcacacatcaacatctaccaagggcca
gagagctgcctgccaggggctcacggcatgggcagccagccgtcaagcttggcagttgtc
aggggctaccagccatgtgccagctttgggggcagcaggcgccaggctatgccgagggac
agccttgctctgcagtcaggacagctcagtgacacaagtcagacctgcagggtgaatggt
atcaagatggagatgaaagggcagccccatccgctgtgctctaatctgcagaattactct
ggtcagttctatgaccaaaccgtgggcttcagtcagcaagacacgaaagctggttcattc
tctatttcagacgccagctgcctgctacaggggaccagcgccaaaaactctgagttactt
tccccaggtgctaatcaggtgacaagcacagtggacagcctcgacagccatgacctggaa
ggggtacagattgacttcgatgccatcatagacgatggggaccactccagcctgatgtcg
ggggccctgagcccaagtatcattcagaacctttcccatagctcctcccgcctcaccacg
cctcgggcgtccctcccattcccagcgctgtccatgagcaccaccaacatggctatcggg
gacatgagttctttgctgacctccctagcggaagaaagcaaattccttgcagttatgcaa
tag

DBGET integrated database retrieval system