KEGG   Homo sapiens (human): 2737Help
Entry
2737              CDS       T01001                                 

Gene name
GLI3, ACLS, GCPS, GLI3-190, GLI3FL, PAP-A, PAPA, PAPA1, PAPB, PHS, PPDIV
Definition
(RefSeq) GLI family zinc finger 3
  KO
K06230  zinc finger protein GLI3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04024  cAMP signaling pathway
hsa04340  Hedgehog signaling pathway
hsa05200  Pathways in cancer
hsa05217  Basal cell carcinoma
Network
nt06217  HH signaling
nt06269  Basal cell carcinoma
  Element
N00010  Mutation-inactivated PTCH1 to Hedgehog signaling pathway
N00017  Mutation-activated SMO to Hedgehog signaling pathway
N00062  Hedgehog signaling pathway
Disease
H00502  Pallister-Hall syndrome
H01226  Polysyndactyly
H01852  Postaxial polydactyly
H02161  Greig cephalopolysyndactyly syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    2737 (GLI3)
   04024 cAMP signaling pathway
    2737 (GLI3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    2737 (GLI3)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    2737 (GLI3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    2737 (GLI3)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, GLI-like
    2737 (GLI3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 FOXP-CC IL17
Motif
Other DBs
NCBI-GeneID: 2737
NCBI-ProteinID: NP_000159
OMIM: 165240
HGNC: 4319
Ensembl: ENSG00000106571
Vega: OTTHUMG00000023630
Pharos: P10071(Tbio)
UniProt: P10071
LinkDB All DBs
Position
7p14.1
AA seq 1580 aa AA seqDB search
MEAQSHSSTTTEKKKVENSIVKCSTRTDVSEKAVASSTTSNEDESPGQTYHRERRNAITM
QPQNVQGLSKVSEEPSTSSDERASLIKKEIHGSLPHVAEPSVPYRGTVFAMDPRNGYMEP
HYHPPHLFPAFHPPVPIDARHHEGRYHYDPSPIPPLHMTSALSSSPTYPDLPFIRISPHR
NPTAASESPFSPPHPYINPYMDYIRSLHSSPSLSMISATRGLSPTDAPHAGVSPAEYYHQ
MALLTGQRSPYADIIPSAATAGTGAIHMEYLHAMDSTRFSSPRLSARPSRKRTLSISPLS
DHSFDLQTMIRTSPNSLVTILNNSRSSSSASGSYGHLSASAISPALSFTYSSAPVSLHMH
QQILSRQQSLGSAFGHSPPLIHPAPTFPTQRPIPGIPTVLNPVQVSSGPSESSQNKPTSE
SAVSSTGDPMHNKRSKIKPDEDLPSPGARGQQEQPEGTTLVKEEGDKDESKQEPEVIYET
NCHWEGCAREFDTQEQLVHHINNDHIHGEKKEFVCRWLDCSREQKPFKAQYMLVVHMRRH
TGEKPHKCTFEGCTKAYSRLENLKTHLRSHTGEKPYVCEHEGCNKAFSNASDRAKHQNRT
HSNEKPYVCKIPGCTKRYTDPSSLRKHVKTVHGPEAHVTKKQRGDIHPRPPPPRDSGSHS
QSRSPGRPTQGALGEQQDLSNTTSKREECLQVKTVKAEKPMTSQPSPGGQSSCSSQQSPI
SNYSNSGLELPLTDGGSIGDLSAIDETPIMDSTISTATTALALQARRNPAGTKWMEHVKL
ERLKQVNGMFPRLNPILPPKAPAVSPLIGNGTQSNNTCSLGGPMTLLPGRSDLSGVDVTM
LNMLNRRDSSASTISSAYLSSRRSSGISPCFSSRRSSEASQAEGRPQNVSVADSYDPIST
DASRRSSEASQSDGLPSLLSLTPAQQYRLKAKYAAATGGPPPTPLPNMERMSLKTRLALL
GDALEPGVALPPVHAPRRCSDGGAHGYGRRHLQPHDAPGHGVRRASDPVRTGSEGLALPR
VPRFSSLSSCNPPAMATSAEKRSLVLQNYTRPEGGQSRNFHSSPCPPSITENVTLESLTM
DADANLNDEDFLPDDVVQYLNSQNQAGYEQHFPSALPDDSKVPHGPGDFDAPGLPDSHAG
QQFHALEQPCPEGSKTDLPIQWNEVSSGSADLSSSKLKCGPRPAVPQTRAFGFCNGMVVH
PQNPLRSGPAGGYQTLGENSNPYGGPEHLMLHNSPGSGTSGNAFHEQPCKAPQYGNCLNR
QPVAPGALDGACGAGIQASKLKSTPMQGSGGQLNFGLPVAPNESAGSMVNGMQNQDPVGQ
GYLAHQLLGDSMQHPGAGRPGQQMLGQISATSHINIYQGPESCLPGAHGMGSQPSSLAVV
RGYQPCASFGGSRRQAMPRDSLALQSGQLSDTSQTCRVNGIKMEMKGQPHPLCSNLQNYS
GQFYDQTVGFSQQDTKAGSFSISDASCLLQGTSAKNSELLSPGANQVTSTVDSLDSHDLE
GVQIDFDAIIDDGDHSSLMSGALSPSIIQNLSHSSSRLTTPRASLPFPALSMSTTNMAIG
DMSSLLTSLAEESKFLAVMQ
NT seq 4743 nt NT seq  +upstreamnt  +downstreamnt
atggaggcccagtcccacagctccacgaccactgaaaagaaaaaagttgagaattccata
gtgaagtgctccactcgaacagatgtgagcgagaaagccgttgcctccagcaccacttct
aatgaggatgaaagtcctggacagacttatcacagagagagaagaaacgcaatcactatg
cagccacagaatgtccaggggctcagcaaagtcagtgaggaaccttcaacatcgagtgac
gagagggcctcattgatcaagaaagagatccatgggtccctgccacacgtggcggagccc
tctgtgccgtaccgcgggacggtgtttgccatggaccccaggaatggttacatggagccc
cactaccaccctcctcatcttttccctgccttccatcctcctgtaccaattgatgccaga
catcatgagggccgttaccattacgatccatctccgattcctccattgcatatgacttcc
gccttatctagtagccctacgtatccggacctgcccttcattaggatctccccacaccgg
aaccccactgctgcttccgagtctcccttcagccctccacatccctacattaatccctac
atggactatatccgctccttgcacagcagcccatcgctctccatgatctcagcaacccgt
gggctgagccctacagatgcgccccatgcaggagtcagcccagcagaatactatcatcag
atggccctgctaactggccagcgcagcccctatgcagacattattccctcagctgccacc
gccggcacgggggccatccacatggaatatcttcatgctatggatagcaccagattctcc
agccccaggctgtcagccaggccgagccgaaaacgtacactgtccatatcaccactctcc
gatcatagctttgaccttcagaccatgataaggacgtctcccaactccttggtcacgatt
ctcaataattcccgtagcagctcttcagcaagtggctcctatggtcacttatctgcaagt
gcaatcagccctgccttgagcttcacctactcttccgcgcccgtctctctccacatgcat
cagcagatcctaagccgacaacagagcttaggttcagcctttggacacagccctccactc
atccaccctgccccaacttttccaacacagaggcctattccagggatccctacggttctg
aaccccgtccaggtcagctccggcccttctgagtcctcacagaacaagcccacgagtgag
tctgcagtgagcagcactggtgacccgatgcacaacaagaggtccaagatcaaacccgat
gaagacctccccagcccaggggctcgggggcagcaggaacagcccgaaggaacaaccctt
gtcaaggaggaaggggacaaagatgaaagcaaacaggagcctgaagtcatctatgagaca
aactgccactgggaaggctgcgcgagggagttcgacacccaagagcagcttgtgcaccat
ataaataacgaccatattcatggagagaagaaggagttcgtgtgcaggtggctggactgc
tcaagagagcagaaacccttcaaagcccagtatatgttggtagtgcatatgagaagacac
acgggcgagaagcctcacaaatgcacttttgaaggttgcacaaaggcctactcgagacta
gaaaacttgaaaacacacttgagatctcacactggagagaaaccatacgtctgtgagcac
gaaggttgcaacaaggctttctcaaatgcctctgatcgcgccaaacaccaaaacagaacg
cattccaatgagaaaccatatgtgtgcaaaatcccaggctgcactaagcgttacacagac
ccaagctccctccggaaacatgtgaagacagtgcatggcccagaggctcatgtcaccaag
aagcagcgaggggacatccatcctcggccgccacccccgagagattccggcagccattca
cagtccaggtcgcctggccgaccgactcagggagcccttggtgagcagcaggacctcagc
aacactacctcaaagcgggaagaatgcctccaggtgaaaaccgtcaaggcagagaagcca
atgacatctcagccaagccctggtggtcagtcttcatgcagcagccaacagtcccccatc
agcaactattccaacagtgggctcgagcttcctctgaccgatggaggtagtataggagac
ctcagtgccatcgatgaaaccccaatcatggactcaaccatttccactgcaaccacagcc
cttgctttgcaagccaggagaaacccggcagggaccaaatggatggagcacgtaaaacta
gaaaggctaaaacaagtgaatggaatgtttccgcgactgaaccccattctaccccctaaa
gcccctgcggtctctcctctcataggaaatggcacacagtccaacaacacctgcagcttg
ggtgggcccatgacgcttctcccgggcagaagcgacctctctggggtggacgtcactatg
ctgaacatgctcaacagaagggacagcagcgccagcaccatcagctcggcctacctgagc
agccgccgctcctcagggatctcgccctgcttctccagccgccgctccagcgaggcgtca
caggccgagggccggccgcagaacgtgagcgtggccgactcctacgaccccatctccacc
gacgcctcgcgccgctccagcgaagccagccagagcgacggcctgcccagcctgctcagc
ctcacgcccgcccagcagtaccgcctcaaggccaagtacgcggctgccacaggagggccg
ccgccgacgcccctgcccaacatggagaggatgagcctgaagacgcgcctggcgctgctc
ggggatgccctcgagcctggcgtggccctgcctccagttcatgccccgaggaggtgcagc
gacgggggagcccacggctacgggcggcgccacctgcagccgcacgatgcgccgggccac
ggcgtgaggagggccagcgacccggtgcggacaggctccgagggcctggccctgcctcgt
gtgccgcgcttcagcagcctcagcagctgcaaccccccggcgatggccacgtccgcggag
aagcgcagtctcgtgcttcagaattacacgcggcccgagggcggccagtcccgaaacttc
cactcgtccccctgtcctcccagcatcaccgagaacgtcaccctggagtccctgaccatg
gacgctgatgccaacctgaacgatgaggatttcctgccggacgacgtggtgcagtattta
aattcccagaaccaagcagggtacgagcagcacttccccagcgccctcccggacgacagc
aaagtgccccacgggcccggtgactttgacgcgcccgggctgccagacagccacgctggc
cagcagttccatgccctcgagcagccctgccccgagggcagcaaaaccgacctgcccatt
cagtggaacgaagtcagctccggaagcgccgacctgtcctcctccaagctcaagtgtggg
ccgcggcccgctgtgccgcagactcgcgcctttgggttctgcaacggcatggtcgtccac
ccgcagaaccccttgaggagcgggcctgctgggggctatcagaccctcggggagaacagc
aacccctacggtggcccagagcacttgatgctccacaacagccccggaagtggcaccagt
ggaaacgccttccatgaacagccctgtaaggccccgcagtatgggaactgtctcaacagg
cagccagtggcccctggtgcactcgacggtgcctgtggtgccgggattcaagcctcaaag
ctgaagagcacccccatgcaagggagcgggggccagctgaatttcggcctgccggtagcg
ccaaatgagtcagctggcagcatggtgaatggcatgcagaaccaggacccagtgggacag
gggtacctggctcaccagctcctcggcgacagcatgcagcacccgggggcaggccgcccc
ggtcagcagatgcttgggcagattagtgctacctcacacatcaacatctaccaagggcca
gagagctgcctgccaggggctcacggcatgggcagccagccgtcaagcttggcagttgtc
aggggctaccagccatgtgccagctttgggggcagcaggcgccaggctatgccgagggac
agccttgctctgcagtcaggacagctcagtgacacaagtcagacctgcagggtgaatggt
atcaagatggagatgaaagggcagccccatccgctgtgctctaatctgcagaattactct
ggtcagttctatgaccaaaccgtgggcttcagtcagcaagacacgaaagctggttcattc
tctatttcagacgccagctgcctgctacaggggaccagcgccaaaaactctgagttactt
tccccaggtgctaatcaggtgacaagcacagtggacagcctcgacagccatgacctggaa
ggggtacagattgacttcgatgccatcatagacgatggggaccactccagcctgatgtcg
ggggccctgagcccaagtatcattcagaacctttcccatagctcctcccgcctcaccacg
cctcgggcgtccctcccattcccagcgctgtccatgagcaccaccaacatggctatcggg
gacatgagttctttgctgacctccctagcggaagaaagcaaattccttgcagttatgcaa
tag

DBGET integrated database retrieval system