KEGG   Homo sapiens (human): 27445
Entry
27445             CDS       T01001                                 

Gene name
PCLO, ACZ, PCH3
Definition
(RefSeq) piccolo presynaptic cytomatrix protein
  KO
K16882  protein piccolo
Organism
hsa  Homo sapiens (human)
Pathway
hsa04911  Insulin secretion
Disease
H00897  Pontocerebellar hypoplasia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    27445 (PCLO)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    27445 (PCLO)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Others
    27445 (PCLO)
SSDB
Motif
Pfam: zf-piccolo C2 PDZ FYVE_2
Other DBs
NCBI-GeneID: 27445
NCBI-ProteinID: NP_149015
OMIM: 604918
HGNC: 13406
Ensembl: ENSG00000186472
Vega: OTTHUMG00000154853
Pharos: Q9Y6V0(Tbio)
UniProt: Q9Y6V0
LinkDB
Structure
PDB: 
1UJD

Position
7q21.11
AA seq 5142 aa
MGNEASLEGEGLPEGLAAAAAAGGGASGAGSPSHTAIPAGMEADLSQLSEEERRQIAAVM
SRAQGLPKGSVPPAAAESPSMHRKQELDSSHPPKQSGRPPDPGRPAQPGLSKSRTTDTFR
SEQKLPGRSPSTISLKESKSRTDLKEEHKSSMMPGFLSEVNALSAVSSVVNKFNPFDLIS
DSEASQEETTKKQKVVQKEQGKPEGIIKPPLQQQPPKPIPKQQGPGRDPLQQDGTPKSIS
SQQPEKIKSQPPGTGKPIQGPTQTPQTDHAKLPLQRDASRPQTKQADIVRGESVKPSLPS
PSKPPIQQPTPGKPPAQQPGHEKSQPGPAKPPAQPSGLTKPLAQQPGTVKPPVQPPGTTK
PPAQPLGPAKPPAQQTGSEKPSSEQPGPKALAQPPGVGKTPAQQPGPAKPPTQQVGTPKP
LAQQPGLQSPAKAPGPTKTPVQQPGPGKIPAQQAGPGKTSAQQTGPTKPPSQLPGPAKPP
PQQPGPAKPPPQQPGSAKPPSQQPGSTKPPPQQPGPAKPSPQQPGSTKPPSQQPGSAKPS
AQQPSPAKPSAQQSTKPVSQTGSGKPLQPPTVSPSAKQPPSQGLPKTICPLCNTTELLLH
VPEKANFNTCTECQTTVCSLCGFNPNPHLTEVKEWLCLNCQMKRALGGDLAPVPSSPQPK
LKTAPVTTTSAVSKSSPQPQQTSPKKDAAPKQDLSKAPEPKKPPPLVKQPTLHGSPSAKA
KQPPEADSLSKPAPPKEPSVPSEQDKAPVADDKPKQPKMVKPTTDLVSSSSATTKPDIPS
SKVQSQAEEKTTPPLKTDSAKPSQSFPPTGEKVSPFDSKAIPRPASDSKIISHPGPSSES
KGQKQVDPVQKKEEPKKAQTKMSPKPDAKPMPKGSPTPPGPRPTAGQTVPTPQQSPKPQE
QSRRFSLNLGSITDAPKSQPTTPQETVTGKLFGFGASIFSQASNLISTAGQPGPHSQSGP
GAPMKQAPAPSQPPTSQGPPKSTGQAPPAPAKSIPVKKETKAPAAEKLEPKAEQAPTVKR
TETEKKPPPIKDSKSLTAEPQKAVLPTKLEKSPKPESTCPLCKTELNIGSKDPPNFNTCT
ECKNQVCNLCGFNPTPHLTEIQEWLCLNCQTQRAISGQLGDIRKMPPAPSGPKASPMPVP
TESSSQKTAVPPQVKLVKKQEQEVKTEAEKVILEKVKETLSMEKIPPMVTTDQKQEESKL
EKDKASALQEKKPLPEEKKLIPEEEKIRSEEKKPLLEEKKPTPEDKKLLPEAKTSAPEEQ
KHDLLKSQVQIAEEKLEGRVAPKTVQEGKQPQTKMEGLPSGTPQSLPKEDDKTTKTIKEQ
PQPPCTAKPDQVEPGKEKTEKEDDKSDTSSSQQPKSPQGLSDTGYSSDGISSSLGEIPSL
IPTDEKDILKGLKKDSFSQESSPSSPSDLAKLESTVLSILEAQASTLADEKSEKKTQPHE
VSPEQPKDQEKTQSLSETLEITISEEEIKESQEERKDTFKKDSQQDIPSSKDHKEKSEFV
DDITTRREPYDSVEESSESENSPVPQRKRRTSVGSSSSDEYKQEDSQGSGEEEDFIRKQI
IEMSADEDASGSEDDEFIRNQLKEISSSTESQKKEETKGKGKITAGKHRRLTRKSSTSID
EDAGRRHSWHDEDDEAFDESPELKYRETKSQESEELVVTGGGGLRRFKTIELNSTIADKY
SAESSQKKTSLYFDEEPELEMESLTDSPEDRSRGEGSSSLHASSFTPGTSPTSVSSLDED
SDSSPSHKKGESKQQRKARHRPHGPLLPTIEDSSEEEELREEEELLKEQEKQREIEQQQR
KSSSKKSKKDKDELRAQRRRERPKTPPSNLSPIEDASPTEELRQAAEMEELHRSSCSEYS
PSIESDPEGFEISPEKIIEVQKVYKLPTAVSLYSPTDEQSIMQKEGSQKALKSAEEMYEE
MMHKTHKYKAFPAANERDEVFEKEPLYGGMLIEDYIYESLVEDTYNGSVDGSLLTRQEEE
NGFMQQKGREQKIRLSEQIYEDPMQKITDLQKEFYELESLHSVVPQEDIVSSSFIIPESH
EIVDLGTMVTSTEEERKLLDADAAYEELMKRQQMQLTPGSSPTQAPIGEDMTESTMDFDR
MPDASLTSSVLSGASLTDSTSSATLSIPDVKITQHFSTEEIEDEYVTDYTREIQEIIAHE
SLILTYSEPSESATSVPPSDTPSLTSSVSSVCTTDSSSPITTLDSITTVYTEPVDMITKF
EDSEEISSSTYFPGSIIDYPEEISVSLDRTAPPDGRASADHIVISLSDMASSIIESVVPK
PEGPVADTVSTDLLISEKDPVKKAKKETGNGIILEVLEAYRDKKELEAERTKSSLSETVF
DHPPSSVIALPMKEQLSTTYFTSGETFGQEKPASQLPSGSPSVSSLPAKPRPFFRSSSLD
ISAQPPPPPPPPPPPPPPPPPPPPPPLPPPTSPKPTILPKKKLTVASPVTTATPLFDAVT
TLETTAVLRSNGLPVTRICTTAPPPVPPKPSSIPSGLVFTHRPEPSKPPIAPKPVIPQLP
TTTQKPTDIHPKPTGLSLTSSMTLNLVTSADYKLPSPTSPLSPHSNKSSPRFSKSLTETY
VVITLPSEPGTPTDSSASQAITSWPLGSPSKDLVSVEPVFSVVPPVTAVEIPISSEQTFY
ISGALQTFSATPVTAPSSFQAAPTSVTQFLTTEVSKTEVSATRSTAPSVGLSSISITIPP
EPLALDNIHLEKPQYKEDGKLQLVGDVIDLRTVPKVEVKTTDKCIDLSASTMDVKRQITA
NEVYGKQISAVQPSIINLSVTSSIVTPVSLATETVTFVTCTASASYTTGTESLVGAEHAM
TTPLQLTTSKHAEPPYRIPSDQVFPIAREEAPINLSLGTPAHAVTLAITKPVTVPPVGVT
NGWTDSTVSQGITDGEVVDLSTTKSHRTVVTMDESTSSVMTKIIEDEKPVDLTAGRRAVC
CDVVYKLPFGRSCTAQQPATTLPEDRFGYRDDHYQYDRSGPYGYRGIGGMKPSMSDTNLA
EAGHFFYKSKNAFDYSEGTDTAVDLTSGRVTTGEVMDYSSKTTGPYPETRQVISGAGIST
PQYSTARMTPPPGPQYCVGSVLRSSNGVVYSSVATPTPSTFAITTQPGSIFSTTVRDLSG
IHTADAVTSLPAMHHSQPMPRSYFITTGASETDIAVTGIDISASLQTITMESLTAETIDS
VPTLTTASEVFPEVVGDESALLIVPEEDKQQQQLDLERELLELEKIKQQRFAEELEWERQ
EIQRFREQEKIMVQKKLEELQSMKQHLLFQQEEERQAQFMMRQETLAQQQLQLEQIQQLQ
QQLHQQLEEQKIRQIYQYNYDPSGTASPQTTTEQAILEGQYAALEGSQFWATEDATTTAS
AVVAIEIPQSQGWYTVQSDGVTQYIAPPGILSTVSEIPLTDVVVKEEKQPKKRSSGAKVR
GQYDDMGENMTDDPRSFKKIVDSGVQTDDEDATDRSYVSRRRRTKKSVDTSVQTDDEDQD
EWDMPTRSRRKARVGKYGDSMTEADKTKPLSKVSSIAVQTVAEISVQTEPVGTIRTPSIR
ARVDAKVEIIKHISAPEKTYKGGSLGCQTEADSDTQSPQYLSATSPPKDKKRPTPLEIGY
SSHLRADSTVQLAPSPPKSPKVLYSPISPLSPGKALESAFVPYEKPLPDDISPQKVLHPD
MAKVPPASPKTAKMMQRSMSDPKPLSPTADESSRAPFQYTEGYTTKGSQTMTSSGAQKKV
KRTLPNPPPEEISTGTQSTFSTMGTVSRRRICRTNTMARAKILQDIDRELDLVERESAKL
RKKQAELDEEEKEIDAKLRYLEMGINRRKEALLKEREKRERAYLQGVAEDRDYMSDSEVS
STRPTRIESQHGIERPRTAPQTEFSQFIPPQTQTESQLVPPTSPYTQYQYSSPALPTQAP
TSYTQQSHFEQQTLYHQQVSPYQTQPTFQAVATMSFTPQVQPTPTPQPSYQLPSQMMVIQ
QKPRQTTLYLEPKITSNYEVIRNQPLMIAPVSTDNTFAVSHLGSKYNSLDLRIGLEERSS
MASSPISSISADSFYADIDHHTPRNYVLIDDIGEITKGTAALSTAFSLHEKDLSKTDRLL
RTTETRRSQEVTDFLAPLQSSSRLHSYVKAEEDPMEDPYELKLLKHQIKQEFRRGTESLD
HLAGLSHYYHADTSYRHFPKSEKYSISRLTLEKQAAKQLPAAILYQKQSKHKKSLIDPKM
SKFSPIQESRDLEPDYSSYMTSSTSSIGGISSRARLLQDDITFGLRKNITDQQKFMGSSL
GTGLGTLGNTIRSALQDEADKPYSSGSRSRPSSRPSSVYGLDLSIKRDSSSSSLRLKAQE
AEALDVSFSHASSSARTKPTSLPISQSRGRIPIVAQNSEEESPLSPVGQPMGMARAAAGP
LPPISADTRDQFGSSHSLPEVQQHMREESRTRGYDRDIAFIMDDFQHAMSDSEAYHLRRE
ETDWFDKPRESRLENGHGLDRKLPERLVHSRPLSQHQEQIIQMNGKTMHYIFPHARIKIT
RDSKDHTVSGNGLGIRIVGGKEIPGHSGEIGAYIAKILPGGSAEQTGKLMEGMQVLEWNG
IPLTSKTYEEVQSIISQQSGEAEICVRLDLNMLSDSENSQHLELHEPPKAVDKAKSPGVD
PKQLAAELQKVSLQQSPLVLSSVVEKGSHVHSGPTSAGSSSVPSPGQPGSPSVSKKKHGS
SKPTDGTKVVSHPITGEIQLQINYDLGNLIIHILQARNLVPRDNNGYSDPFVKVYLLPGR
GQVMVVQNASAEYKRRTKHVQKSLNPEWNQTVIYKSISMEQLKKKTLEVTVWDYDRFSSN
DFLGEVLIDLSSTSHLDNTPRWYPLKEQTESIDHGKSHSSQSSQQSPKPSVIKSRSHGIF
PDPSKDMQVPTIEKSHSSPGSSKSSSEGHLRSHGPSRSQSKTSVTQTHLEDAGAAIAAAE
AAVQQLRIQPTKPPNHRPAESSVSTGSSGSSFGSGYSVDSEGSSSTAGETNLFPIPRIGK
MGQNGQEPVKQPGVGVGLADTEAKTQVMGEIKIALKKEMKTDGEQLIVEILQCRNITYKF
KSPDHLPDLYVKIYVMNISTQKKVIKKKTRVCRHDREPSFNETFRFSLSPAGHSLQILLF
SNGGKFMKKTLIGEACIWLDKVDLRKRIVNWHKLLVSPTQTH
NT seq 15429 nt   +upstreamnt  +downstreamnt
atgggcaacgaggcgagcttggaaggggaagggctccccgaagggctggcggcggccgca
gcggctggaggaggagctagcggggcggggagcccctctcacaccgcgatcccggccggc
atggaggcggatttgagccagctgagcgaagaggagaggagacagatcgccgctgtcatg
tcaagggcgcaggggctgcccaagggaagcgtccccccggccgctgcggagtcgccttcc
atgcacaggaaacaagagttggatagtagtcatcctccaaagcaatcaggaagacccccg
gaccctgggcgtccagctcaacctggtctcagtaaaagtagaactacagacactttcagg
tcagagcagaaattgcctgggaggagtccttccactattagcttgaaagaatcaaagtcc
agaactgatttaaaggaagagcacaagtctagtatgatgcctggcttcctctcagaggtt
aacgctttaagtgctgtttcctctgttgtaaataaattcaacccttttgatttgatatca
gactctgaggcatcccaggaagaaaccaccaagaaacaaaaagtggttcagaaggagcaa
ggaaaacctgaaggaatcataaaacctcctttacaacaacagccacccaagccgattcct
aagcagcaaggacctggtagggatccgcttcagcaggatggcactcccaaatcaatatct
tctcaacaaccagaaaaaattaaatcacaacctccaggtacaggaaagccaattcagggt
cctacccagactcctcagacagaccatgcaaaattgccacttcaacgagatgcatccagg
cctcagactaaacaggcagacatagtaaggggagaatcagttaaaccctcactgccaagc
ccatccaaaccacctattcagcaaccaactcctggaaaacctccagcacagcagcctgga
catgaaaaatcacagcctgggcctgcaaagcccccagctcagccctcagggctaacaaag
ccattggctcaacaaccagggacagtgaaacccccagtccagccaccagggacaacaaag
cctccagctcagcctcttggtcctgctaagcctccagctcagcagactgggtcagagaag
ccttcatcggagcagcctgggccaaaggctttagctcagcctcctggagttggaaagact
ccagctcaacagccagggccagcaaagcctccaacccagcaggtggggacaccaaaaccc
ctagctcaacaacctgggctacagtctccagctaaggcacctgggcctacaaagactcca
gttcagcagcctgggccaggaaagattccagctcaacaggcaggacccggaaagacttct
gcccagcagactggcccaacaaagcctccttcacaactgcctggcccagcaaagccccca
cctcaacagcctggcccagcaaagcccccacctcaacagcctggctcagcaaagccccca
tctcaacagcctggctcaacaaaacccccacctcaacagcctggcccagcaaagccctca
cctcaacagcctggctcaacaaaacccccatctcaacagcctggctcagcaaaaccctca
gctcaacagcctagcccagcaaagccctcggctcagcaatctacaaaaccagtaagccaa
acaggatctggaaaacctctgcagccaccaacagtgtctccatctgcaaaacagcctcct
tcacaaggcctccctaaaaccatctgtcctctttgcaataccactgaacttctgttgcat
gttccagaaaaggccaattttaacacatgcactgagtgtcaaaccactgtctgtagtctc
tgtggttttaatcccaatcctcatttaacggaggtaaaagagtggctctgtttgaactgt
caaatgaaaagagctctaggcggggatctggctccagttccgtcatcaccccagcccaaa
ctgaagactgcacctgttaccactacatcagcagtgagcaaatcatccccacagccacag
cagacttccccaaagaaggatgctgcaccaaaacaggatctctccaaggcacctgagcct
aaaaagccaccaccactagtgaaacaaccaacccttcatggctctccttcagccaaggcc
aagcagccccctgaggcagattctttgtccaagccagcccctcccaaagaaccttctgtc
ccatctgagcaggacaaggcccctgttgctgatgataaaccaaagcagcccaagatggta
aagccaaccactgaccttgtatcttcatcatcagcaacaacaaaacctgatattccaagc
tccaaagtacagtcacaagctgaagagaaaacaacccctcctctaaaaacagactctgcc
aaaccctcacagagttttccaccaacaggggaaaaagtcagcccatttgattctaaagcc
atacctcgacctgcatcagattcaaaaattatttcacatcctggtcccagttcagagagc
aaaggtcaaaaacaagttgaccccgtacaaaagaaggaagaacccaagaaagcacaaacc
aaaatgagtcctaaaccagatgccaagccaatgccaaaagggtcaccaacaccccctggc
ccacgacctaccgctggccaaactgtccccacacctcaacagtccccaaagcctcaggag
cagtcaaggcgtttcagtctgaatctgggaagtattactgatgcccccaaatcacagcct
acaactcctcaagagaccgtgactgggaaactctttgggtttggagcatcaatcttcagc
caggcatcaaatttaatttccactgcaggccaacctggacctcattcacaaagtggacca
ggggccccaatgaaacaagcccctgccccttcacagccacctacttcacaagggccaccc
aaatccacaggtcaagcaccaccagcacctgcaaaaagtatacctgtgaaaaaggaaaca
aaagccccagcagctgaaaaattagagcccaaagctgaacaagctccaacagtaaaaaga
acagaaacagaaaaaaagccaccacctattaaggatagcaaatctttaacagctgagcct
caaaaggctgtccttcccacaaaactggagaaatcgcccaaaccagaatcaacctgtcct
ctctgcaaaactgaactcaacataggttctaaggatcctcctaacttcaatacttgcact
gaatgcaagaatcaagtgtgtaatctctgtggatttaaccctacaccacatttgactgag
attcaagaatggctttgtttaaattgccaaacccagagagcaatatcaggacagcttgga
gacatacgcaaaatgccacctgcaccatcaggacccaaagcatctcctatgcctgttcct
acagaatcatcatctcagaaaacagcagtgcctccccaagtaaaattagtgaaaaagcaa
gaacaagaagtaaaaacggaagctgaaaaagtcattctggaaaaagtaaaggaaacacta
tcaatggaaaaaattcctcctatggtaaccacagatcaaaaacaagaagagagtaaacta
gagaaagacaaagcttcagctcttcaagaaaaaaagccactccctgaagaaaaaaaacta
atccctgaagaagaaaagatacgttctgaagaaaaaaagccactcctagaagaaaaaaag
ccaacccctgaagacaaaaagctactcccagaggcaaaaacatcagccccagaagaacag
aaacatgacttacttaaatctcaagtacaaattgctgaagaaaagcttgaaggcagagtg
gctccaaagacagtgcaagaagggaaacaaccacagaccaagatggaaggtttaccatct
ggcacacctcagagtttacctaaagaagatgataagacaaccaaaacaataaaagaacag
ccacagccaccatgcacagcaaaacctgatcaggtggaacctgggaaagaaaaaacagaa
aaggaagatgacaaatcagacacctcaagttctcagcagcctaaaagcccccaaggtctg
agcgacacgggatattcttccgatggaatatcaagctcacttggtgaaattccaagtctt
attccaactgatgaaaaggatattctcaagggactcaaaaaggactctttttcacaagaa
agcagcccttccagcccctcagatttggctaagttagaaagtacagtcctatctattttg
gaagctcaagcaagtacacttgctgatgaaaagtcagaaaagaaaacacaaccccatgaa
gtttctcctgaacagcctaaagaccaagagaaaactcagagtttatctgaaaccttggaa
attactatttcagaagaggagatcaaagagagtcaagaagaaaggaaagacacttttaaa
aaagatagccaacaagatattccttccagcaaggaccataaagagaagtctgagtttgtt
gatgacataactactagaagagagccttatgattcagttgaagagagtagtgaaagtgaa
aactcacctgttccacaaagaaaacgaagaactagtgttggctcatcaagcagtgatgag
tataaacaggaagacagccaaggatcaggggaagaggaggacttcattcgaaaacaaatc
atagaaatgagtgctgatgaagatgcttcaggttctgaagatgatgagttcatcagaaac
cagctcaaagagattagtagcagtactgagagccagaagaaggaagaaacaaagggaaaa
ggcaaaataacagcagggaaacacagacgactgactcgaaaaagtagcacaagcattgat
gaagatgcaggaagacgtcactcatggcatgatgaagacgatgaagcatttgatgaaagt
cctgaacttaaatacagagaaactaaaagtcaggaaagtgaagaacttgtagttactgga
ggaggagggctacgccgatttaaaacaattgagctcaacagtacaatagcagataaatat
tctgcagagtcatcacagaaaaaaacaagtttgtattttgacgaagagccagaattggaa
atggaaagcctgacagactcacctgaagataggtcaaggggagagggatcttcgagtctg
catgcttccagcttcactcctggtacatcccctacatcagtatcatcacttgatgaggac
agtgacagtagcccgagtcacaaaaaaggagagagcaaacagcaacgcaaagctcggcac
agaccacatggccctcttttgcctactattgaagattcttcagaggaagaagaattgaga
gaggaagaagaattattaaaggagcaagaaaagcagagggaaatagaacagcaacaaaga
aagagttctagtaaaaaatcaaagaaagacaaagatgaacttcgagctcagagaagaagg
gaaaggccaaagacaccacctagtaatctctctcccattgaagatgcatctccgacagaa
gagttacgtcaggctgcagaaatggaggagctccatagatcttcttgttctgaatattca
cctagcatagagtcagacccagaaggttttgaaataagcccggaaaaaataatagaagta
caaaaagtttataaattgcccacagctgtttcattatactcaccaacagatgagcaatct
attatgcagaaagaaggtagccaaaaggcgttaaaaagtgctgaggagatgtatgaagaa
atgatgcataaaacacacaaatacaaagcttttccagctgcaaatgaacgagatgaagtg
tttgaaaaagagcctttgtatggtgggatgctaatagaggattatatttatgaatcttta
gtagaagacacgtacaatggatcggtagatggcagtctgctaacaaggcaagaagaagaa
aatggatttatgcagcagaaaggaagagagcaaaagataagactttcagaacagatttat
gaagatcctatgcagaaaattacagacctccagaaagagttttatgagttagaaagctta
cattctgttgtgcctcaggaagatattgtttcaagctcttttatcatcccagaaagccat
gagatagtggacctgggtactatggtaacttctacagaagaagaaaggaaactactagat
gctgatgctgcctatgaagaacttatgaagaggcaacagatgcaattaacacctggatct
agcccaacccaggcccccattggtgaggatatgacagagtccaccatggactttgacaga
atgccagatgcctctttgacatcaagtgttctctcaggagcgtctcttacagattcgacc
agcagtgcaacactctctatcccagatgttaaaataacccaacatttttcaacagaagaa
attgaggatgaatatgtaaccgattatacaagagaaattcaagagataattgcccatgaa
tcgctgattttgacctactcggagccttcagaaagtgctacatctgtcccaccctctgac
acaccttctctcacatcatctgtttcttcggtctgtaccacagatagctcttcacccatt
actaccctggatagcataaccacagtttatacagagccagtggacatgataactaaattt
gaagattctgaggaaatttcttcatcaacttattttccaggcagcattatagactatcca
gaagaaataagtgtatctttagatcggactgccccaccagatggtagagctagtgctgat
catattgttatttccttatctgatatggcatcttctatcatagaatctgtagtacctaaa
cctgaagggccagttgctgacactgtttctactgacttacttatatctgaaaaggaccca
gtgaagaaagccaagaaggaaactgggaatggaatcattctggaagttttggaagcttac
agagataaaaaggagttggaggccgaacgaacaaaaagtagcttatccgaaaccgtgttt
gatcacccaccttcttctgtaatagcccttccaatgaaagagcagctttcaactacatac
tttacatctggagagacctttggtcaggaaaaacctgcatctcagttaccatctggcagt
ccttctgtttcctctcttccagctaaacctcgcccattctttagaagttcttctttggat
atatcagctcaacctcctccccctcctccccctccccctcctcctcctcctccaccacca
ccccctcctcccccaccacttcctccaccaacttcacctaaaccaactattcttcctaaa
aaaaagttaacagttgcatctccagtgactacagctacacctctgtttgatgctgttact
actctagagaccacagctgttctgagaagtaatggattacctgttacaagaatatgtact
actgcacctcctcctgttcctcctaagccatcttcaattccatctggacttgtatttacc
cacaggcctgagccaagcaaacctccaatcgcccccaaaccagtgattcctcagcttcca
acaactacacaaaaaccaacagatatacaccccaaaccaacaggcctatctttaacttca
agtatgaccttaaatttagtgacttcagcagattataaattgccttcccctacctcccca
ctttccccacactccaacaagtcttcaccaagattttccaaatccctcacagaaacttat
gtagttattacattgccatctgaaccagggactccaacagattcttctgctagtcaagca
attaccagttggcccttgggatcaccctccaaagatctggtttctgttgaacctgtgttt
tctgtagttcctcctgtgacagctgtagaaattccaatttcttcagaacagaccttctac
atctctggagctttacagacattttctgctacccctgtcacagcaccctcttcatttcaa
gcagctcccacatcagttacacagtttctcactactgaagtttccaagactgaggtttca
gcaaccagaagtacagctcctagtgttggtctcagcagcatttccataacaattcctcca
gagcctcttgctctagataacatacatttagagaagcctcagtataaagaagatggaaaa
ttgcaacttgttggtgatgtaattgatttgcgtacagtaccaaaggtagaagttaaaaca
actgataaatgtattgatctttctgcttctacaatggatgtgaaaaggcagatcacagca
aatgaagtttatgggaaacaaattagtgctgtccaaccctctattataaatcttagtgtg
acatcatcaatagtgactcctgtatctctggccactgagacagtgacctttgtcacatgc
acagctagtgcaagttacactacaggcacagaaagcctagtgggtgcagaacatgcaatg
acaacaccactccaacttacaacatcaaagcatgctgagcccccatacaggataccaagt
gaccaggtctttcctatagctagggaagaagcaccaataaacttatctctaggtactcca
gcacatgcagtgacattggctattacaaaacctgtcactgtgcctcctgttggtgtcaca
aatggatggactgatagcaccgtatcccagggaatcactgatggggaagtagtggatctc
agtacaaccaagtctcacagaacagtcgtaacaatggatgagtctacttcaagtgtgatg
accaaaataatagaagatgaaaaacccgttgatttaaccgcagggagaagagctgtgtgc
tgtgatgtggtttataaattaccatttggaaggagctgcacagcacagcagcctgcaact
actcttcctgaggatcgttttggttatagggatgaccactatcagtatgatcgatcaggg
ccatatggttatagagggattgggggaatgaagccttccatgtctgacacaaatttagca
gaagctggacattttttctataaaagtaagaatgcttttgattattctgaaggaactgac
acagcagtagatctgacttcagggagagttactacaggtgaggtaatggattattcaagc
aagactacaggtccatatccagaaacacgacaagtcatttcaggagctgggattagtacc
ccacagtattccacagcaagaatgacaccaccaccaggaccccagtattgtgtggggagt
gttttgaggtcatctaatggtgttgtctattcttcagtagcaactccaacaccctctaca
tttgctatcaccacacaacctggctccattttcagcaccacagtgagggatttgtctggt
attcatacggctgatgcagtgacttcattacctgccatgcaccatagccagccaatgcct
agatcatattttataacaacaggtgcatctgaaacggacattgcagtaactggtattgat
atcagtgccagtttgcaaactattactatggagtctcttactgctgagacgatagactct
gttcccactttaaccacagcatccgaagtgtttcctgaagtggtgggagatgaaagtgct
cttttaattgtccctgaagaagataaacaacagcagcagctagacttggagcgtgagctc
ctggaactggagaaaattaagcaacagcgctttgctgaggaattggagtgggaacgtcag
gaaattcaaaggttccgagaacaagaaaagatcatggttcagaaaaagttggaggagctg
cagtctatgaagcaacaccttctctttcagcaagaagaagagcggcaagcccagttcatg
atgaggcaggagacgttagctcagcaacagttacagcttgagcagatccaacagctgcaa
caacagcttcaccagcagctggaggagcaaaagattcggcagatctaccagtataactat
gacccttctggaactgcttctccacaaaccactacagagcaggcaattttggaaggtcag
tatgctgctctggaaggcagtcaattttgggcaactgaagatgcaaccaccacagcttca
gctgttgtggcaattgaaataccacaaagccaaggatggtacaccgttcagtctgatggt
gttactcagtacattgccccacctggtatcctgagcactgtttcagaaatacctctaaca
gatgttgttgtgaaagaggaaaaacaacccaaaaagagaagttctggagctaaagtccga
ggacagtatgatgacatgggagaaaatatgacagatgatccccgaagttttaaaaagata
gtggacagtggtgtacaaacggatgacgaagatgccacagatcggagctatgtgagtagg
agaaggagaactaaaaagagtgtggatacaagcgtccaaactgatgatgaagatcaggat
gagtgggatatgcctactagatcaaggaggaaagctcgtgtagggaaatatggtgacagc
atgacagaggctgacaagaccaaacccctttccaaagtctccagcatagcagttcaaacg
gtagcagagatatctgtgcaaactgaaccagttggaaccataagaacaccctccatacgg
gcacgagtggatgccaaggtagaaataattaaacacatttcagcacctgaaaagacttac
aaagggggcagtttaggatgtcaaacagaagcagattcagacacacaaagtcctcaatat
ctgagtgccacatctccacccaaagacaagaaacgcccaacacctttagagattggttat
tcatctcacctccgggcagattccacagtacagctggctccttccccacccaaatccccc
aaagtcctttactcacccatctcaccactttcaccaggcaaagccttagaatcagccttt
gtaccttatgaaaaacccctccctgatgatataagtccacagaaagtactgcatccagat
atggctaaagttcccccagcaagtcctaagacagccaagatgatgcagcgttctatgtct
gaccccaagcctctgagtccaacagcagacgaaagttccagggctccttttcagtatacc
gagggctatacgactaaaggttctcaaaccatgacatcctctggagcccagaaaaaagtt
aaaagaactctgccaaatccacctcctgaggagatttccacaggaactcaatccacattc
agcacaatgggcacagtttccaggagaaggatctgcagaaccaacacaatggcacgagcc
aagattctccaggacatagacagagagcttgatcttgtggaaagggagtctgcaaaactt
cgaaagaaacaagcagagcttgatgaagaagaaaaggagattgatgctaagctacgatac
ctggaaatgggaattaacaggaggaaagaggccctattaaaggagagagaaaagagagaa
cgagcctacctccagggagtagctgaggatcgtgattacatgtctgacagtgaagtgagt
agcacaagaccaacccgaatagaaagtcagcatggcattgagcgaccaagaactgctccc
caaactgaattcagccagtttataccaccacaaacccaaacagaatctcaactagttcct
ccgacaagtccttacacacaataccagtactcttcccctgctcttcctacccaagcaccc
acctcatacactcaacagtctcattttgagcaacaaactttgtaccatcagcaagtttca
ccttatcagactcagccaacattccaagctgtggcaacaatgtccttcacacctcaagtt
caacctacaccaaccccacagccttcttatcagttaccttcacagatgatggtgatacaa
cagaagccacggcaaactacattatatttggagcccaagataacctcaaactatgaagtg
attcgcaaccaaccccttatgatagcacctgtttctacggataacacatttgctgtttcc
catcttggtagtaagtacaatagtttagacttgagaataggtttggaggaaagaagtagc
atggcaagcagtccaatatcaagcatatctgcagattctttctatgcagatattgatcac
catactccacgaaattatgtcctaattgacgacattggagagatcaccaaaggaacagcg
gcattaagcaccgcatttagccttcatgaaaaggatctgtcaaaaacagaccgtctcctt
cgaaccactgagacacgccggtctcaagaagtgacagatttcctagcacctttacagtct
tcctctagattgcatagttatgtgaaggcggaggaagacccaatggaggatccttacgag
ttaaagcttctgaaacatcagattaaacaggaatttcgtagagggacagagagcttagat
caccttgctggtctttctcattattaccatgctgatactagctacagacattttccaaaa
tctgagaagtatagcatcagtagactcacacttgaaaaacaagcagcaaaacaactgcca
gcagccatactttatcaaaagcagtcaaagcataagaaatcactaattgaccctaaaatg
tcaaaattttcacctattcaagaaagtagagaccttgaacctgattattcaagctatatg
acttctagcacttcatctattggtggcatttcctccagggcaaggctccttcaagatgac
atcacttttggcctcagaaaaaatattacagaccaacaaaaatttatgggatcttctctt
ggcacaggactgggcacattaggaaataccatacgctcagctctgcaggatgaagcggat
aagccatacagtagtggcagcaggtccagaccttcctccagaccttcctctgtctatggg
cttgatttatcaattaaaagggattcttctagctcttccctaagactgaaagctcaagag
gctgaagctctagatgtttcctttagtcatgcatcatcctctgccagaactaagccgacc
agtttgccaattagtcaaagtagaggaagaataccaattgtggcccagaattctgaagaa
gaaagcccactcagtcctgttggccagccaatgggaatggccagggctgcagctggaccc
ctgccaccaatatctgcagacaccagggatcagtttggatcaagccactcattgcctgaa
gttcagcaacacatgagggaagaatcacggactcgaggctatgaccgtgacatagcattc
atcatggatgacttccaacatgccatgtcagacagtgaagcctatcatctgcgtcgtgag
gaaacagattggtttgataaacccagggagtctcgtttggaaaatggacatggtctggac
cgaaaactgccggaaagattggtccactctagaccactcagtcaacatcaagagcaaatt
atacagatgaacgggaaaactatgcactacatctttcctcacgcaaggataaaaataaca
agagactcaaaggatcacacagtttcaggtaatggattaggaattagaattgtgggtggt
aaagaaatcccgggacatagtggagaaattggagcctatattgccaagattcttcctggg
ggaagtgcggaacagacggggaagcttatggaagggatgcaagtattggaatggaatgga
attcccttgacttctaaaacatatgaagaagttcagagtatcattagtcagcaaagtggg
gaagcagaaatatgtgtaagactggacctcaatatgctatcagattctgaaaattcccag
catctggaacttcatgagccaccaaaagctgtggataaggcgaaatccccaggggttgat
cctaagcagttggcagcagaactccagaaggtttcactacagcagtcaccgctggttctg
tcatcagttgttgaaaaaggatctcatgttcattcaggtcctacatcagcaggatccagt
tccgttcccagccctgggcaaccagggtccccctcagtgagcaaaaagaagcacggcagc
agcaagcctaccgatggaacaaaggttgtctctcatccaattacaggagaaattcagctt
caaattaactatgatcttggaaatctcataatacatattctccaagcaagaaatcttgtt
cctcgagacaacaatggttattctgacccttttgtgaaagtgtaccttcttccagggaga
ggtcaagtcatggttgtccagaatgcaagtgctgagtacaagagaaggactaaacatgtc
cagaaaagtcttaatcctgagtggaatcaaacagtaatttataaaagtatttccatggaa
cagctcaagaagaaaacactggaggtgacagtttgggattatgatagattttcatccaac
gacttccttggggaggtattgattgatttatctagcacatctcacctcgataacactcca
aggtggtatcctctcaaagaacagactgaaagcattgatcatggcaagtctcattccagt
cagagcagccagcagtccccaaagccatctgttatcaaaagcagaagccatggtatcttc
cctgacccatcaaaggacatgcaggttcccaccattgagaaatcccatagtagtcctggt
agctcaaaatcatcatcagaaggccatctccgttctcatggaccatctcgcagtcaaagc
aaaaccagcgtcactcagacccacctggaagatgcaggggctgccatagctgctgccgaa
gctgccgtgcaacaactccgcattcaaccaacaaagcctcccaatcaccggcctgcagaa
agctctgtgtccaccggctcctcgggcagcagctttggcagtgggtatagcgtggacagt
gaaggaagcagcagcactgcaggggagactaatctatttcctattccgaggatagggaag
atgggacagaatggacaagagcctgtaaaacagccaggggtaggagtaggactagcagac
actgaagctaaaactcaggtaatgggagaaatcaagattgcattgaagaaggaaatgaag
acagatggtgaacaactaatagttgaaattctccaatgcagaaatattacatacaaattt
aagtctcctgatcatctaccagatttatatgtgaaaatatatgtgatgaatatttctacc
caaaaaaaggtgatcaagaaaaaaacaagagtatgcagacatgatcgagagccttcgttt
aatgaaacttttcgattcagtctaagtcctgcaggacattctcttcagattttacttttc
tccaatggagggaagtttatgaaaaagaccttgattggtgaagcctgtatctggcttgac
aaagtggatctcagaaaaagaatagtcaactggcacaaacttttggtcagtcctactcaa
acgcattga

DBGET integrated database retrieval system