KEGG   Homo sapiens (human): 276
Entry
276               CDS       T01001                                 

Gene name
AMY1A, AMY1
Definition
(RefSeq) amylase alpha 1A
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00500  Starch and sucrose metabolism
hsa01100  Metabolic pathways
hsa04970  Salivary secretion
hsa04972  Pancreatic secretion
hsa04973  Carbohydrate digestion and absorption
Network
nt06017  Glycogen metabolism
  Element
N00720  Glycogen degradation (amylase)
N00747  GAA deficiency in glycogen degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    276 (AMY1A)
 09150 Organismal Systems
  09154 Digestive system
   04970 Salivary secretion
    276 (AMY1A)
   04972 Pancreatic secretion
    276 (AMY1A)
   04973 Carbohydrate digestion and absorption
    276 (AMY1A)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     276 (AMY1A)
SSDB
Motif
Pfam: Alpha-amylase_C Alpha-amylase DUF3078
Other DBs
NCBI-GeneID: 276
NCBI-ProteinID: NP_001008222
OMIM: 104700
HGNC: 474
Ensembl: ENSG00000237763
Vega: OTTHUMG00000011020
UniProt: P04745 Q6NSB3
LinkDB
Structure
PDB: 

Position
1p21.1
AA seq 511 aa
MKLFWLLFTIGFCWAQYSSNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPP
NENVAIHNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGN
AVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLSGL
LDLALGKDYVRSKIAEYMNHLIDIGVAGFRIDASKHMWPGDIKAILDKLHNLNSNWFPEG
SKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWG
FMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWP
RYFENGKDVNDWVGPPNDNGVTKEVTINPDTTCGNDWVCEHRWRQIRNMVNFRNVVDGQP
FTNWYDNGSNQVAFGRGNRGFIVFNNDDWTFSLTLQTGLPAGTYCDVISGDKINGNCTGI
KIYVSDDGKAHFSISNSAEDPFIAIHAESKL
NT seq 1536 nt   +upstreamnt  +downstreamnt
atgaagctcttttggttgcttttcaccattgggttctgctgggctcagtattcctcaaat
acacaacaaggacgaacatctattgttcatctgtttgaatggcgatgggttgatattgct
cttgaatgtgagcgatatttagctcccaagggatttggaggggttcaggtctctccacca
aatgaaaatgttgccattcacaaccctttcagaccttggtgggaaagataccaaccagtt
agctataaattatgcacaagatctggaaatgaagatgaatttagaaacatggtgactaga
tgcaacaatgttggggttcgtatttatgtggatgctgtaattaatcatatgtgtggtaat
gctgtgagtgcaggaacaagcagtacctgtggaagttacttcaaccctggaagtagggac
tttccagcagtcccatattctggatgggattttaatgatggtaaatgtaaaactggaagt
ggagatatcgagaactataatgatgctactcaggtcagagattgtcgtctgtctggtctt
ctcgatcttgcactggggaaggattatgtgcgttctaagattgccgaatatatgaaccat
ctcattgacattggtgttgcagggttcagaattgatgcttccaagcacatgtggcctgga
gacataaaggcaattttggacaaactgcataatctaaacagtaactggttcccggaaggt
agtaaacctttcatttaccaggaggtaattgatctgggtggtgagccaattaaaagcagt
gactactttggtaatggccgggtgacagaattcaagtatggtgcaaaactcggcacagtt
attcgcaagtggaatggagagaagatgtcttacttaaagaactggggagaaggttggggt
ttcatgccttctgacagagcgcttgtctttgtggataaccatgacaatcaacgaggacat
ggcgctggaggagcctctatacttaccttctgggatgctaggctgtacaaaatggcagtt
ggatttatgcttgctcatccttatggatttacacgagtaatgtcaagctaccgttggcca
agatattttgaaaatggaaaagatgttaatgattgggttgggccaccaaatgataatgga
gtaactaaagaagttactattaatccagacactacttgtggcaatgactgggtctgtgaa
catcgatggcgccaaataaggaacatggttaatttccgcaatgtagtggatggccagcct
tttacaaactggtatgataatgggagcaaccaagtggcttttgggagaggaaacagagga
ttcattgttttcaacaatgatgactggacattttctttaactttgcaaactggtcttcct
gctggcacatactgtgatgtcatttctggagataaaattaatggcaactgcacaggcatt
aaaatctacgtttctgatgatggcaaagctcatttttctattagtaactctgctgaagat
ccatttattgcaattcatgctgaatctaaattgtaa

KEGG   Homo sapiens (human): 277
Entry
277               CDS       T01001                                 

Gene name
AMY1B, AMY1
Definition
(RefSeq) amylase alpha 1B
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00500  Starch and sucrose metabolism
hsa01100  Metabolic pathways
hsa04970  Salivary secretion
hsa04972  Pancreatic secretion
hsa04973  Carbohydrate digestion and absorption
Network
nt06017  Glycogen metabolism
  Element
N00720  Glycogen degradation (amylase)
N00747  GAA deficiency in glycogen degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    277 (AMY1B)
 09150 Organismal Systems
  09154 Digestive system
   04970 Salivary secretion
    277 (AMY1B)
   04972 Pancreatic secretion
    277 (AMY1B)
   04973 Carbohydrate digestion and absorption
    277 (AMY1B)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     277 (AMY1B)
SSDB
Motif
Pfam: Alpha-amylase_C Alpha-amylase DUF3078
Other DBs
NCBI-GeneID: 277
NCBI-ProteinID: NP_001008219
OMIM: 104701
HGNC: 475
Ensembl: ENSG00000174876
Vega: OTTHUMG00000011021
UniProt: P04745
LinkDB
Structure
PDB: 

Position
1p21.1
AA seq 511 aa
MKLFWLLFTIGFCWAQYSSNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPP
NENVAIHNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGN
AVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLSGL
LDLALGKDYVRSKIAEYMNHLIDIGVAGFRIDASKHMWPGDIKAILDKLHNLNSNWFPEG
SKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWG
FMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWP
RYFENGKDVNDWVGPPNDNGVTKEVTINPDTTCGNDWVCEHRWRQIRNMVNFRNVVDGQP
FTNWYDNGSNQVAFGRGNRGFIVFNNDDWTFSLTLQTGLPAGTYCDVISGDKINGNCTGI
KIYVSDDGKAHFSISNSAEDPFIAIHAESKL
NT seq 1536 nt   +upstreamnt  +downstreamnt
atgaagctcttttggttgcttttcaccattgggttctgctgggctcagtattcctcaaat
acacaacaaggacgaacatctattgttcatctgtttgaatggcgatgggttgatattgct
cttgaatgtgagcgatatttagctcccaagggatttggaggggttcaggtctctccacca
aatgaaaatgttgccattcacaaccctttcagaccttggtgggaaagataccaaccagtt
agctataaattatgcacaagatctggaaatgaagatgaatttagaaacatggtgactaga
tgcaacaatgttggggttcgtatttatgtggatgctgtaattaatcatatgtgtggtaat
gctgtgagtgcaggaacaagcagtacctgtggaagttacttcaaccctggaagtagggac
tttccagcagtcccatattctggatgggattttaatgatggtaaatgtaaaactggaagt
ggagatatcgagaactataatgatgctactcaggtcagagattgtcgtctgtctggtctt
ctcgatcttgcactggggaaggattatgtgcgttctaagattgccgaatatatgaaccat
ctcattgacattggtgttgcagggttcagaattgatgcttccaagcacatgtggcctgga
gacataaaggcaattttggacaaactgcataatctaaacagtaactggttcccggaaggt
agtaaacctttcatttaccaggaggtaattgatctgggtggtgagccaattaaaagcagt
gactactttggtaatggccgggtgacagaattcaagtatggtgcaaaactcggcacagtt
attcgcaagtggaatggagagaagatgtcttacttaaagaactggggagaaggttggggt
ttcatgccttctgacagagcgcttgtctttgtggataaccatgacaatcaacgaggacat
ggcgctggaggagcctctatacttaccttctgggatgctaggctgtacaaaatggcagtt
ggatttatgcttgctcatccttatggatttacacgagtaatgtcaagctaccgttggcca
agatattttgaaaatggaaaagatgttaatgattgggttgggccaccaaatgataatgga
gtaactaaagaagttactattaatccagacactacttgtggcaatgactgggtctgtgaa
catcgatggcgccaaataaggaacatggttaatttccgcaatgtagtggatggccagcct
tttacaaactggtatgataatgggagcaaccaagtggcttttgggagaggaaacagagga
ttcattgttttcaacaatgatgactggacattttctttaactttgcaaactggtcttcct
gctggcacatactgtgatgtcatttctggagataaaattaatggcaactgcacaggcatt
aaaatctacgtttctgatgatggcaaagctcatttttctattagtaactctgctgaagat
ccatttattgcaattcatgctgaatctaaattgtaa

KEGG   Homo sapiens (human): 278
Entry
278               CDS       T01001                                 

Gene name
AMY1C, AMY1
Definition
(RefSeq) amylase alpha 1C
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00500  Starch and sucrose metabolism
hsa01100  Metabolic pathways
hsa04970  Salivary secretion
hsa04972  Pancreatic secretion
hsa04973  Carbohydrate digestion and absorption
Network
nt06017  Glycogen metabolism
  Element
N00720  Glycogen degradation (amylase)
N00747  GAA deficiency in glycogen degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    278 (AMY1C)
 09150 Organismal Systems
  09154 Digestive system
   04970 Salivary secretion
    278 (AMY1C)
   04972 Pancreatic secretion
    278 (AMY1C)
   04973 Carbohydrate digestion and absorption
    278 (AMY1C)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     278 (AMY1C)
SSDB
Motif
Pfam: Alpha-amylase_C Alpha-amylase DUF3078
Other DBs
NCBI-GeneID: 278
NCBI-ProteinID: NP_001008220
OMIM: 104702
HGNC: 476
Ensembl: ENSG00000187733
Vega: OTTHUMG00000011045
Pharos: P04745(Tchem)
UniProt: P04745
LinkDB
Structure
PDB: 

Position
1p21.1
AA seq 511 aa
MKLFWLLFTIGFCWAQYSSNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPP
NENVAIHNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGN
AVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLSGL
LDLALGKDYVRSKIAEYMNHLIDIGVAGFRIDASKHMWPGDIKAILDKLHNLNSNWFPEG
SKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWG
FMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWP
RYFENGKDVNDWVGPPNDNGVTKEVTINPDTTCGNDWVCEHRWRQIRNMVNFRNVVDGQP
FTNWYDNGSNQVAFGRGNRGFIVFNNDDWTFSLTLQTGLPAGTYCDVISGDKINGNCTGI
KIYVSDDGKAHFSISNSAEDPFIAIHAESKL
NT seq 1536 nt   +upstreamnt  +downstreamnt
atgaagctcttttggttgcttttcaccattgggttctgctgggctcagtattcctcaaat
acacaacaaggacgaacatctattgttcatctgtttgaatggcgatgggttgatattgct
cttgaatgtgagcgatatttagctcccaagggatttggaggggttcaggtctctccacca
aatgaaaatgttgccattcacaaccctttcagaccttggtgggaaagataccaaccagtt
agctataaattatgcacaagatctggaaatgaagatgaatttagaaacatggtgactaga
tgcaacaatgttggggttcgtatttatgtggatgctgtaattaatcatatgtgtggtaat
gctgtgagtgcaggaacaagcagtacctgtggaagttacttcaaccctggaagtagggac
tttccagcagtcccatattctggatgggattttaatgatggtaaatgtaaaactggaagt
ggagatatcgagaactataatgatgctactcaggtcagagattgtcgtctgtctggtctt
ctcgatcttgcactggggaaggattatgtgcgttctaagattgccgaatatatgaaccat
ctcattgacattggtgttgcagggttcagaattgatgcttccaagcacatgtggcctgga
gacataaaggcaattttggacaaactgcataatctaaacagtaactggttcccggaaggt
agtaaacctttcatttaccaggaggtaattgatctgggtggtgagccaattaaaagcagt
gactactttggtaatggccgggtgacagaattcaagtatggtgcaaaactcggcacagtt
attcgcaagtggaatggagagaagatgtcttacttaaagaactggggagaaggttggggt
ttcatgccttctgacagagcgcttgtctttgtggataaccatgacaatcaacgaggacat
ggcgctggaggagcctctatacttaccttctgggatgctaggctgtacaaaatggcagtt
ggatttatgcttgctcatccttatggatttacacgagtaatgtcaagctaccgttggcca
agatattttgaaaatggaaaagatgttaatgattgggttgggccaccaaatgataatgga
gtaactaaagaagttactattaatccagacactacttgtggcaatgactgggtctgtgaa
catcgatggcgccaaataaggaacatggttaatttccgcaatgtagtggatggccagcct
tttacaaactggtatgataatgggagcaaccaagtggcttttgggagaggaaacagagga
ttcattgttttcaacaatgatgactggacattttctttaactttgcaaactggtcttcct
gctggcacatactgtgatgtcatttctggagataaaattaatggcaactgcacaggcatt
aaaatctacgtttctgatgatggcaaagctcatttttctattagtaactctgctgaagat
ccatttattgcaattcatgctgaatctaaattgtaa

KEGG   Homo sapiens (human): 279
Entry
279               CDS       T01001                                 

Gene name
AMY2A, AMY2, PA
Definition
(RefSeq) amylase alpha 2A
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00500  Starch and sucrose metabolism
hsa01100  Metabolic pathways
hsa04970  Salivary secretion
hsa04972  Pancreatic secretion
hsa04973  Carbohydrate digestion and absorption
Network
nt06017  Glycogen metabolism
  Element
N00720  Glycogen degradation (amylase)
N00747  GAA deficiency in glycogen degradation
Drug target
Acarbose: D00216<JP/US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    279 (AMY2A)
 09150 Organismal Systems
  09154 Digestive system
   04970 Salivary secretion
    279 (AMY2A)
   04972 Pancreatic secretion
    279 (AMY2A)
   04973 Carbohydrate digestion and absorption
    279 (AMY2A)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     279 (AMY2A)
SSDB
Motif
Pfam: Alpha-amylase_C Alpha-amylase DUF3078
Other DBs
NCBI-GeneID: 279
NCBI-ProteinID: NP_000690
OMIM: 104650
HGNC: 477
Ensembl: ENSG00000243480
Vega: OTTHUMG00000011023
Pharos: P04746(Tclin)
UniProt: P04746 Q53F26
LinkDB
Structure
PDB: 

Position
1p21.1
AA seq 511 aa
MKFFLLLFTIGFCWAQYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPP
NENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGN
AVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGL
LDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAG
SKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWG
FVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWP
RQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQP
FTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGI
KIYVSDDGKAHFSISNSAEDPFIAIHAESKL
NT seq 1536 nt   +upstreamnt  +downstreamnt
atgaagttctttctgttgcttttcaccattgggttctgctgggctcagtattccccaaat
acacaacaaggacggacatctattgttcatctgtttgaatggcgatgggttgatattgct
cttgaatgtgagcgatatttagctccgaagggatttggaggggttcaggtctctccacca
aatgaaaatgttgcaatttacaaccctttcagaccttggtgggaaagataccaaccagtt
agctataaattatgcacaagatctggaaatgaagatgaatttagaaacatggtgactaga
tgtaacaatgttggggttcgtatttatgtggatgctgtaattaatcatatgtgtggtaac
gctgtgagtgcaggaacaagcagtacctgtggaagttacttcaaccctggaagtagggac
tttccagcagtcccatattctggatgggatttcaatgatggtaaatgtaaaactggaagt
ggagatatcgagaactacaatgatgctactcaggtcagagattgtcgtctgactggtctt
cttgatcttgcactggagaaggattacgtgcgttctaagattgccgaatatatgaaccat
ctcattgacattggtgttgcagggttcagacttgatgcttccaagcacatgtggcctgga
gacataaaggcaattttggacaaactgcataatctaaacagtaactggttccctgcagga
agtaaacctttcatttaccaggaggtaattgatctgggtggtgagccaattaaaagcagt
gactactttggtaatggccgggtgacagaattcaagtatggtgcaaaactcggcacagtt
attcgcaagtggaatggagagaagatgtcttacttaaagaactggggagaaggttggggt
ttcgtaccttctgacagagcgcttgtctttgtggataaccatgacaatcaacgaggacat
ggggctggaggagcctctattcttaccttctgggatgctaggctgtacaaaatggcagtt
ggatttatgcttgctcatccttacggatttacacgagtaatgtcaagctaccgttggcca
agacagtttcaaaatggaaacgatgttaatgattgggttgggccaccaaataataatgga
gtaattaaagaagttactattaatccagacactacttgtggcaatgactgggtctgtgaa
catcgatggcgccaaataaggaacatggttattttccgcaatgtagtggatggccagcct
tttacaaattggtatgataatgggagcaaccaagtggcttttgggagaggaaacagagga
ttcattgttttcaacaatgatgactggtcattttctttaactttgcaaactggtcttcct
gctggcacatactgtgatgtcatttctggagataaaattaatggcaattgcacaggcatt
aaaatttacgtttctgatgatggcaaagctcatttttctattagtaactctgctgaagat
ccatttattgcaattcatgctgaatctaaattgtaa

KEGG   Homo sapiens (human): 280
Entry
280               CDS       T01001                                 

Gene name
AMY2B, AMY2, AMY3, HXA
Definition
(RefSeq) amylase alpha 2B
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00500  Starch and sucrose metabolism
hsa01100  Metabolic pathways
hsa04970  Salivary secretion
hsa04972  Pancreatic secretion
hsa04973  Carbohydrate digestion and absorption
Network
nt06017  Glycogen metabolism
  Element
N00720  Glycogen degradation (amylase)
N00747  GAA deficiency in glycogen degradation
Drug target
Acarbose: D00216<JP/US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    280 (AMY2B)
 09150 Organismal Systems
  09154 Digestive system
   04970 Salivary secretion
    280 (AMY2B)
   04972 Pancreatic secretion
    280 (AMY2B)
   04973 Carbohydrate digestion and absorption
    280 (AMY2B)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     280 (AMY2B)
SSDB
Motif
Pfam: Alpha-amylase_C Alpha-amylase DUF3078
Other DBs
NCBI-GeneID: 280
NCBI-ProteinID: NP_066188
OMIM: 104660
HGNC: 478
Ensembl: ENSG00000240038
Vega: OTTHUMG00000011024
Pharos: P19961(Tbio)
UniProt: P19961
LinkDB
Position
1p21.1
AA seq 511 aa
MKFFLLLFTIGFCWAQYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPP
NENVAIHNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMSGN
AVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLVGL
LDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAG
SKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWG
FMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWP
RQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVNFRNVVDGQP
FTNWYDNGSNQVAFGRGNRGFIVFNNDDWTFSLTLQTGLPAGTYCDVISGDKINGNCTGI
KIYVSDDGKAHFSISNSAEDPFIAIHAESKL
NT seq 1536 nt   +upstreamnt  +downstreamnt
atgaagttctttctgttgcttttcaccattgggttctgctgggctcagtattccccaaat
acacaacaaggacggacatctattgttcatctgtttgaatggcgatgggttgatattgct
cttgaatgtgagcgatatttagctcccaagggatttggaggggttcaggtctctccacca
aatgaaaatgttgcaattcacaaccctttcagaccttggtgggaaagataccaaccagtt
agctataaattatgcacaagatctggaaatgaagatgaatttagaaacatggtgactaga
tgtaacaatgttggggttcgtatttatgtggatgctgtaattaatcatatgtctggtaat
gctgtgagtgcaggaacaagcagtacctgtggaagttacttcaaccctggaagtagggac
tttccagcagtcccatattctggatgggattttaatgatggtaaatgtaaaactggaagt
ggagatatcgagaactacaatgatgctactcaggtcagagattgtcgtctggttggtctt
cttgatcttgcactggagaaagattatgtgcgttccaagattgccgaatatatgaatcat
ctcattgacattggtgttgcagggttcagacttgatgcttccaagcacatgtggcctgga
gacataaaggcaattttggacaaactgcataatctaaacagtaactggttccctgcagga
agtaaacctttcatttaccaggaggtaattgatctgggtggtgagccaattaaaagcagt
gactactttggaaatggccgggtgacagaattcaagtatggtgcaaaactcggcacagtt
attcgcaagtggaatggagagaagatgtcttacctaaagaactggggagaaggttggggt
ttcatgccttctgacagagcacttgtctttgtggataaccatgacaatcaacgaggacat
ggggctggaggagcctctattcttaccttctgggatgctaggctgtataaaatggcagtt
ggatttatgcttgctcatccttatggttttacacgagtaatgtcaagctaccgttggcca
agacagtttcaaaatggaaacgatgttaatgattgggttgggccaccaaataataatgga
gtaattaaagaagttactattaatccagacactacttgtggcaatgactgggtctgtgaa
catcgatggcgccaaataaggaacatggttaatttccgcaatgtagtggatggccagcct
tttacaaactggtatgataatgggagcaaccaagtggcttttgggagaggaaacagagga
ttcattgttttcaacaatgatgactggacattttctttaactttgcaaactggtcttcct
gctggcacatactgtgatgtcatttctggagataaaattaatggcaattgcacaggcatt
aaaatctacgtttctgacgatggcaaagctcatttttctattagtaactctgctgaggat
ccatttattgcaattcatgctgaatctaaattataa

DBGET integrated database retrieval system