KEGG   Homo sapiens (human): 2768Help
Entry
2768              CDS       T01001                                 

Gene name
GNA12, NNX3, RMP, gep
Definition
(RefSeq) G protein subunit alpha 12
  KO
K04346  guanine nucleotide-binding protein subunit alpha-12
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04022  cGMP-PKG signaling pathway
hsa04071  Sphingolipid signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04270  Vascular smooth muscle contraction
hsa04730  Long-term depression
hsa04810  Regulation of actin cytoskeleton
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa05130  Pathogenic Escherichia coli infection
hsa05163  Human cytomegalovirus infection
hsa05200  Pathways in cancer
Network
nt06124  Chemokine signaling (virus)
nt06167  Human cytomegalovirus (HCMV)
  Element
N00405  CXCR4-GNA12/13-Rho signaling pathway
N00406  HCMV US28 to GNA12/13-Rho signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    2768 (GNA12)
   04072 Phospholipase D signaling pathway
    2768 (GNA12)
   04071 Sphingolipid signaling pathway
    2768 (GNA12)
   04022 cGMP-PKG signaling pathway
    2768 (GNA12)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    2768 (GNA12)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    2768 (GNA12)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    2768 (GNA12)
  09156 Nervous system
   04730 Long-term depression
    2768 (GNA12)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    2768 (GNA12)
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    2768 (GNA12)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    2768 (GNA12)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    2768 (GNA12)
   04031 GTP-binding proteins [BR:hsa04031]
    2768 (GNA12)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   2768 (GNA12)
GTP-binding proteins [BR:hsa04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 4 (G12/13)
    2768 (GNA12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G-alpha Arf Gtr1_RagA GTP_EFTU FtsK_SpoIIIE
Motif
Other DBs
NCBI-GeneID: 2768
NCBI-ProteinID: NP_031379
OMIM: 604394
HGNC: 4380
Ensembl: ENSG00000146535
Vega: OTTHUMG00000023064
Pharos: Q03113(Tbio)
UniProt: Q03113 Q6ZQV4
LinkDB All DBs
Position
7p22.3-p22.2
AA seq 381 aa AA seqDB search
MSGVVRTLSRCLLPAEAGGARERRAGSGARDAEREARRRSRDIDALLARERRAVRRLVKI
LLLGAGESGKSTFLKQMRIIHGREFDQKALLEFRDTIFDNILKGSRVLVDARDKLGIPWQ
YSENEKHGMFLMAFENKAGLPVEPATFQLYVPALSALWRDSGIREAFSRRSEFQLGESVK
YFLDNLDRIGQLNYFPSKQDILLARKATKGIVEHDFVIKKIPFKMVDVGGQRSQRQKWFQ
CFDGITSILFMVSSSEYDQVLMEDRRTNRLVESMNIFETIVNNKLFFNVSIILFLNKMDL
LVEKVKTVSIKKHFPDFRGDPHRLEDVQRYLVQCFDRKRRNRSKPLFHHFTTAIDTENVR
FVFHAVKDTILQENLKDIMLQ
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgtccggggtggtgcggaccctcagccgctgcctgctgccggccgaggccggcggggcc
cgcgagcgcagggcgggcagcggcgcgcgcgacgcggagcgcgaggcccggaggcgtagc
cgcgacatcgacgcgctgctggcccgcgagcggcgcgcggtccggcgcctggtgaagatc
ctgctgctgggcgcgggcgagagcggcaagtccacgttcctcaagcagatgcgcatcatc
cacggccgcgagttcgaccagaaggcgctgctggagttccgcgacaccatcttcgacaac
atcctcaagggctcaagggttcttgttgatgcacgagataagcttggcattccttggcag
tattctgaaaatgagaagcatgggatgttcctgatggccttcgagaacaaggcggggctg
cctgtggagccggccaccttccagctgtacgtcccggccctgagcgcactctggagggat
tctggcatcagggaggctttcagccggagaagcgagtttcagctgggggagtcggtgaag
tacttcctggacaacttggaccggatcggccagctgaattactttcctagtaagcaagat
atcctgctggctaggaaagccaccaagggaattgtggagcatgacttcgttattaagaag
atcccctttaagatggtggatgtgggcggccagcggtcccagcgccagaagtggttccag
tgcttcgacgggatcacgtccatcctgttcatggtctcctccagcgagtacgaccaggtc
ctcatggaggacaggcgcaccaaccggctggtggagtccatgaacatcttcgagaccatc
gtcaacaacaagctcttcttcaacgtctccatcattctcttcctcaacaagatggacctc
ctggtggagaaggtgaagaccgtgagcatcaagaagcacttcccggacttcaggggcgac
ccgcacaggctggaggacgtccagcgctacctggtccagtgcttcgacaggaagagacgg
aaccgcagcaagccactcttccaccacttcaccaccgccatcgacaccgagaacgtccgc
ttcgtgttccatgctgtgaaagacaccatcctgcaggagaacctgaaggacatcatgctg
cagtga

DBGET integrated database retrieval system