KEGG   Homo sapiens (human): 2769
Entry
2769              CDS       T01001                                 

Gene name
GNA15, GNA16
Definition
(RefSeq) G protein subunit alpha 15
  KO
K04637  guanine nucleotide-binding protein subunit alpha-15
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04926  Relaxin signaling pathway
hsa05142  Chagas disease
hsa05146  Amoebiasis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    2769 (GNA15)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    2769 (GNA15)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    2769 (GNA15)
   05142 Chagas disease
    2769 (GNA15)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:hsa04031]
    2769 (GNA15)
GTP-binding proteins [BR:hsa04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 3 (Gq/11) [OT]
    2769 (GNA15)
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA AAA_29 Rad17 TniB AAA_24
Other DBs
NCBI-GeneID: 2769
NCBI-ProteinID: NP_002059
OMIM: 139314
HGNC: 4383
Ensembl: ENSG00000060558
Vega: OTTHUMG00000180637
Pharos: P30679(Tbio)
UniProt: P30679
LinkDB
Position
19p13.3
AA seq 374 aa
MARSLTWRCCPWCLTEDEKAAARVDQEINRILLEQKKQDRGELKLLLLGPGESGKSTFIK
QMRIIHGAGYSEEERKGFRPLVYQNIFVSMRAMIEAMERLQIPFSRPESKHHASLVMSQD
PYKVTTFEKRYAAAMQWLWRDAGIRACYERRREFHLLDSAVYYLSHLERITEEGYVPTAQ
DVLRSRMPTTGINEYCFSVQKTNLRIVDVGGQKSERKKWIHCFENVIALIYLASLSEYDQ
CLEENNQENRMKESLALFGTILELPWFKSTSVILFLNKTDILEEKIPTSHLATYFPSFQG
PKQDAEAAKRFILDMYTRMYTGCVDGPEGSKKGARSRRLFSHYTCATDTQNIRKVFKDVR
DSVLARYLDEINLL
NT seq 1125 nt   +upstreamnt  +downstreamnt
atggcccgctcgctgacctggcgctgctgcccctggtgcctgacggaggatgagaaggcc
gccgcccgggtggaccaggagatcaacaggatcctcttggagcagaagaagcaggaccgc
ggggagctgaagctgctgcttttgggcccaggcgagagcgggaagagcaccttcatcaag
cagatgcggatcatccacggcgccggctactcggaggaggagcgcaagggcttccggccc
ctggtctaccagaacatcttcgtgtccatgcgggccatgatcgaggccatggagcggctg
cagattccattcagcaggcccgagagcaagcaccacgctagcctggtcatgagccaggac
ccctataaagtgaccacgtttgagaagcgctacgctgcggccatgcagtggctgtggagg
gatgccggcatccgggcctgctatgagcgtcggcgggaattccacctgctcgattcagcc
gtgtactacctgtcccacctggagcgcatcaccgaggagggctacgtccccacagctcag
gacgtgctccgcagccgcatgcccaccactggcatcaacgagtactgcttctccgtgcag
aaaaccaacctgcggatcgtggacgtcgggggccagaagtcagagcgtaagaaatggatc
cattgtttcgagaacgtgatcgccctcatctacctggcctcactgagtgaatacgaccag
tgcctggaggagaacaaccaggagaaccgcatgaaggagagcctcgcattgtttgggact
atcctggaactaccctggttcaaaagcacatccgtcatcctctttctcaacaaaaccgac
atcctggaggagaaaatccccacctcccacctggctacctatttccccagtttccagggc
cctaagcaggatgctgaggcagccaagaggttcatcctggacatgtacacgaggatgtac
accgggtgcgtggacggccccgagggcagcaagaagggcgcacgatcccgacgcctcttc
agccactacacatgtgccacagacacacagaacatccgcaaggtcttcaaggacgtgcgg
gactcggtgctcgcccgctacctggacgagatcaacctgctgtga

DBGET integrated database retrieval system