KEGG   Homo sapiens (human): 280Help
Entry
280               CDS       T01001                                 

Gene name
AMY2B, AMY2, AMY3, HXA
Definition
(RefSeq) amylase, alpha 2B (pancreatic)
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00500  Starch and sucrose metabolism
hsa01100  Metabolic pathways
hsa04972  Pancreatic secretion
hsa04973  Carbohydrate digestion and absorption
Drug target
Acarbose: D00216
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    280 (AMY2B)
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    280 (AMY2B)
   04973 Carbohydrate digestion and absorption
    280 (AMY2B)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     280 (AMY2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase_C Alpha-amylase DUF3078
Motif
Other DBs
NCBI-GeneID: 280
NCBI-ProteinID: NP_066188
OMIM: 104660
HGNC: 478
Ensembl: ENSG00000240038
Vega: OTTHUMG00000011024
Pharos: P19961(Tbio)
UniProt: P19961
LinkDB All DBs
Position
1p21.1
AA seq 511 aa AA seqDB search
MKFFLLLFTIGFCWAQYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPP
NENVAIHNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMSGN
AVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLVGL
LDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAG
SKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWG
FMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWP
RQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVNFRNVVDGQP
FTNWYDNGSNQVAFGRGNRGFIVFNNDDWTFSLTLQTGLPAGTYCDVISGDKINGNCTGI
KIYVSDDGKAHFSISNSAEDPFIAIHAESKL
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgaagttctttctgttgcttttcaccattgggttctgctgggctcagtattccccaaat
acacaacaaggacggacatctattgttcatctgtttgaatggcgatgggttgatattgct
cttgaatgtgagcgatatttagctcccaagggatttggaggggttcaggtctctccacca
aatgaaaatgttgcaattcacaaccctttcagaccttggtgggaaagataccaaccagtt
agctataaattatgcacaagatctggaaatgaagatgaatttagaaacatggtgactaga
tgtaacaatgttggggttcgtatttatgtggatgctgtaattaatcatatgtctggtaat
gctgtgagtgcaggaacaagcagtacctgtggaagttacttcaaccctggaagtagggac
tttccagcagtcccatattctggatgggattttaatgatggtaaatgtaaaactggaagt
ggagatatcgagaactacaatgatgctactcaggtcagagattgtcgtctggttggtctt
cttgatcttgcactggagaaagattatgtgcgttccaagattgccgaatatatgaatcat
ctcattgacattggtgttgcagggttcagacttgatgcttccaagcacatgtggcctgga
gacataaaggcaattttggacaaactgcataatctaaacagtaactggttccctgcagga
agtaaacctttcatttaccaggaggtaattgatctgggtggtgagccaattaaaagcagt
gactactttggaaatggccgggtgacagaattcaagtatggtgcaaaactcggcacagtt
attcgcaagtggaatggagagaagatgtcttacctaaagaactggggagaaggttggggt
ttcatgccttctgacagagcacttgtctttgtggataaccatgacaatcaacgaggacat
ggggctggaggagcctctattcttaccttctgggatgctaggctgtataaaatggcagtt
ggatttatgcttgctcatccttatggttttacacgagtaatgtcaagctaccgttggcca
agacagtttcaaaatggaaacgatgttaatgattgggttgggccaccaaataataatgga
gtaattaaagaagttactattaatccagacactacttgtggcaatgactgggtctgtgaa
catcgatggcgccaaataaggaacatggttaatttccgcaatgtagtggatggccagcct
tttacaaactggtatgataatgggagcaaccaagtggcttttgggagaggaaacagagga
ttcattgttttcaacaatgatgactggacattttctttaactttgcaaactggtcttcct
gctggcacatactgtgatgtcatttctggagataaaattaatggcaattgcacaggcatt
aaaatctacgtttctgacgatggcaaagctcatttttctattagtaactctgctgaggat
ccatttattgcaattcatgctgaatctaaattataa

DBGET integrated database retrieval system