KEGG   Homo sapiens (human): 2811
Entry
2811              CDS       T01001                                 

Gene name
GP1BA, BDPLT1, BDPLT3, BSS, CD42B, CD42b-alpha, DBPLT3, GP1B, GPIbA, GPIbalpha, VWDP
Definition
(RefSeq) glycoprotein Ib platelet subunit alpha
  KO
K06261  platelet glycoprotein Ib alpha chain
Organism
hsa  Homo sapiens (human)
Pathway
hsa04512  ECM-receptor interaction
hsa04611  Platelet activation
hsa04613  Neutrophil extracellular trap formation
hsa04640  Hematopoietic cell lineage
Disease
H00219  Hemophilia
H00224  Bernard-Soulier syndrome
H01740  Macrothrombocytopenia
H02093  Platelet-type von Willebrand disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    2811 (GP1BA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    2811 (GP1BA)
   04611 Platelet activation
    2811 (GP1BA)
   04613 Neutrophil extracellular trap formation
    2811 (GP1BA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    2811 (GP1BA)
CD molecules [BR:hsa04090]
 Proteins
  2811 (GP1BA)
SSDB
Motif
Pfam: LRR_8 LRR_4 LRRNT LRR_9
Other DBs
NCBI-GeneID: 2811
NCBI-ProteinID: NP_000164
OMIM: 606672
HGNC: 4439
Ensembl: ENSG00000185245
Vega: OTTHUMG00000177946
Pharos: P07359(Tbio)
UniProt: P07359 L7UYB8
LinkDB
Structure
PDB: 

Position
17p13.2
AA seq 652 aa
MPLLLLLLLLPSPLHPHPICEVSKVASHLEVNCDKRNLTALPPDLPKDTTILHLSENLLY
TFSLATLMPYTRLTQLNLDRCELTKLQVDGTLPVLGTLDLSHNQLQSLPLLGQTLPALTV
LDVSFNRLTSLPLGALRGLGELQELYLKGNELKTLPPGLLTPTPKLEKLSLANNNLTELP
AGLLNGLENLDTLLLQENSLYTIPKGFFGSHLLPFAFLHGNPWLCNCEILYFRRWLQDNA
ENVYVWKQGVDVKAMTSNVASVQCDNSDKFPVYKYPGKGCPTLGDEGDTDLYDYYPEEDT
EGDKVRATRTVVKFPTKAHTTPWGLFYSWSTASLDSQMPSSLHPTQESTKEQTTFPPRWT
PNFTLHMESITFSKTPKSTTEPTPSPTTSEPVPEPAPNMTTLEPTPSPTTPEPTSEPAPS
PTTPEPTSEPAPSPTTPEPTSEPAPSPTTPEPTPIPTIATSPTILVSATSLITPKSTFLT
TTKPVSLLESTKKTIPELDQPPKLRGVLQGHLESSRNDPFLHPDFCCLLPLGFYVLGLFW
LLFASVVLILLLSWVGHVKPQALDSGQGAALTTATQTTHLELQRGRQVTVPRAWLLFLRG
SLPTFRSSLFLWVRPNGRVGPLVAGRRPSALSQGRGQDLLSTVSIRYSGHSL
NT seq 1959 nt   +upstreamnt  +downstreamnt
atgcctctcctcctcttgctgctcctgctgccaagccccttacacccccaccccatctgt
gaggtctccaaagtggccagccacctagaagtgaactgtgacaagaggaatctgacagcg
ctgcctccagacctgccgaaagacacaaccatcctccacctgagtgagaacctcctgtac
accttctccctggcaaccctgatgccttacactcgcctcactcagctgaacctagatagg
tgcgagctcaccaagctccaggtcgatgggacgctgccagtgctggggaccctggatcta
tcccacaatcagctgcaaagcctgcccttgctagggcagacactgcctgctctcaccgtc
ctggacgtctccttcaaccggctgacctcgctgcctcttggtgccctgcgtggtcttggc
gaactccaagagctctacctgaaaggcaatgagctgaagaccctgcccccagggctcctg
acgcccacacccaagctggagaagctcagtctggctaacaacaacttgactgagctcccc
gctgggctcctgaatgggctggagaatctcgacacccttctcctccaagagaactcgctg
tatacaataccaaagggcttttttgggtcccacctcctgccttttgcttttctccacggg
aacccctggttatgcaactgtgagatcctctattttcgtcgctggctgcaggacaatgct
gaaaatgtctacgtatggaagcaaggtgtggacgtcaaggccatgacctctaacgtggcc
agtgtgcagtgtgacaattcagacaagtttcccgtctacaaatacccaggaaaggggtgc
cccacccttggtgatgaaggtgacacagacctatatgattactacccagaagaggacact
gagggcgataaggtgcgtgccacaaggactgtggtcaagttccccaccaaagcccataca
accccctggggtctattctactcatggtccactgcttctctagacagccaaatgccctcc
tccttgcatccaacacaagaatccactaaggagcagaccacattcccacctagatggacc
ccaaatttcacacttcacatggaatccatcacattctccaaaactccaaaatccactact
gaaccaaccccaagcccgaccacctcagagcccgtcccggagcccgccccaaacatgacc
accctggagcccactccaagcccgaccaccccagagcccacctcagagcccgcccccagc
ccgaccaccccggagcccacctcagagcccgcccccagcccgaccaccccagagcccacc
tcagagcccgcccccagcccgaccaccccggagcccaccccaatcccgaccatcgccaca
agcccgaccatcctggtgtctgccacaagcctgatcactccaaaaagcacatttttaact
accacaaaacccgtatcactcttagaatccaccaaaaaaaccatccctgaacttgatcag
ccaccaaagctccgtggggtgctccaagggcatttggagagctccagaaatgaccctttt
ctccaccccgacttttgctgcctcctccccctgggcttctatgtcttgggtctcttctgg
ctgctctttgcctctgtggtcctcatcctgctgctgagctgggttgggcatgtgaaacca
caggccctggactctggccaaggtgctgctctgaccacagccacacaaaccacacacctg
gagctgcagaggggacggcaagtgacagtgccccgggcctggctgctcttccttcgaggt
tcgcttcccactttccgctccagcctcttcctgtgggtacggcctaatggccgtgtgggg
cctctagtggcaggaaggaggccctcagctctgagtcagggtcgtggtcaggacctgctg
agcacagtgagcattaggtactctggccacagcctctga

DBGET integrated database retrieval system