KEGG   Homo sapiens (human): 2814Help
Entry
2814              CDS       T01001                                 

Gene name
GP5, CD42d, GPV
Definition
(RefSeq) glycoprotein V platelet
  KO
K06260  platelet glycoprotein V
Organism
hsa  Homo sapiens (human)
Pathway
hsa04512  ECM-receptor interaction
hsa04611  Platelet activation
hsa04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    2814 (GP5)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    2814 (GP5)
   04611 Platelet activation
    2814 (GP5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    2814 (GP5)
CD molecules [BR:hsa04090]
 Proteins
  2814 (GP5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_8 LRR_4 LRR_5 LRR_9 LRRCT LRR_1
Motif
Other DBs
NCBI-GeneID: 2814
NCBI-ProteinID: NP_004479
OMIM: 173511
HGNC: 4443
Ensembl: ENSG00000178732
Vega: OTTHUMG00000150345
Pharos: P40197(Tbio)
UniProt: P40197
LinkDB All DBs
Position
3q29
AA seq 560 aa AA seqDB search
MLRGTLLCAVLGLLRAQPFPCPPACKCVFRDAAQCSGGDVARISALGLPTNLTHILLFGM
GRGVLQSQSFSGMTVLQRLMISDSHISAVAPGTFSDLIKLKTLRLSRNKITHLPGALLDK
MVLLEQLFLDHNALRGIDQNMFQKLVNLQELALNQNQLDFLPASLFTNLENLKLLDLSGN
NLTHLPKGLLGAQAKLERLLLHSNRLVSLDSGLLNSLGALTELQFHRNHIRSIAPGAFDR
LPNLSSLTLSRNHLAFLPSALFLHSHNLTLLTLFENPLAELPGVLFGEMGGLQELWLNRT
QLRTLPAAAFRNLSRLRYLGVTLSPRLSALPQGAFQGLGELQVLALHSNGLTALPDGLLR
GLGKLRQVSLRRNRLRALPRALFRNLSSLESVQLDHNQLETLPGDVFGALPRLTEVLLGH
NSWRCDCGLGPFLGWLRQHLGLVGGEEPPRCAGPGAHAGLPLWALPGGDAECPGPRGPPP
RPAADSSSEAPVHPALAPNSSEPWVWAQPVTTGKGQDHSPFWGFYFLLLAVQAMITVIIV
FAMIKIGQLFRKLIRERALG
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgctgagggggactctactgtgcgcggtgctcgggcttctgcgcgcccagcccttcccc
tgtccgccagcttgcaagtgtgtcttccgggacgccgcgcagtgctcggggggcgacgtg
gcgcgcatctccgcgctaggcctgcccaccaacctcacgcacatcctgctcttcggaatg
ggccgcggcgtcctgcagagccagagcttcagcggcatgaccgtcctgcagcgcctcatg
atctccgacagccacatttccgccgttgcccccggcaccttcagtgacctgataaaactg
aaaaccctgaggctgtcgcgcaacaaaatcacgcatcttccaggtgcgctgctggataag
atggtgctcctggagcagttgtttttggaccacaatgcgctaaggggcattgaccaaaac
atgtttcagaaactggttaacctgcaggagctcgctctgaaccagaatcagctcgatttc
cttcctgccagtctcttcacgaatctggagaacctgaagttgttggatttatcgggaaac
aacctgacccacctgcccaaggggttgcttggagcacaggctaagctcgagagacttctg
ctccactcgaaccgccttgtgtctctggattcggggctgttgaacagcctgggcgccctg
acggagctgcagttccaccgaaatcacatccgttccatcgcacccggggccttcgaccgg
ctcccaaacctcagttctttgacgctttcgagaaaccaccttgcgtttctcccctctgcg
ctctttcttcattcgcacaatctgactctgttgactctgttcgagaacccgctggcagag
ctcccgggggtgctcttcggggagatggggggcctgcaggagctgtggctgaaccgcacc
cagctgcgcaccctgcccgccgccgccttccgcaacctgagccgcctgcggtacttaggg
gtgactctgagcccgcggctgagcgcgcttccgcagggcgccttccagggccttggcgag
ctccaggtgctcgccctgcactccaacggcctgaccgccctccccgacggcttgctgcgc
ggcctcggcaagctgcgccaggtgtccctgcgccgcaacaggctgcgcgccctgccccgt
gccctcttccgcaatctcagcagcctggagagcgtccagctcgaccacaaccagctggag
accctgcctggcgacgtgtttggggctctgccccggctgacggaggtcctgttggggcac
aactcctggcgctgcgactgtggcctggggcccttcctggggtggctgcggcagcaccta
ggcctcgtgggcggggaagagcccccacggtgcgcaggccctggggcgcacgccggcctg
ccgctctgggccctgccggggggtgacgcggagtgcccgggcccccggggcccgcctccc
cgccccgctgcggacagctcctcggaagcccctgtccacccagccttggctcccaacagc
tcagaaccctgggtgtgggcccagccggtgaccacgggcaaaggtcaagatcatagtccg
ttctgggggttttattttctgcttttagctgttcaggccatgatcaccgtgatcatcgtg
tttgctatgattaaaattggccaactctttcgaaaattaatcagagagagagcccttggg
taa

DBGET integrated database retrieval system