KEGG   Homo sapiens (human): 2817
Entry
2817              CDS       T01001                                 

Gene name
GPC1, glypican
Definition
(RefSeq) glypican 1
  KO
K08107  glypican 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa05205  Proteoglycans in cancer
hsa05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    2817 (GPC1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    2817 (GPC1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:hsa00535]
    2817 (GPC1)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
    2817 (GPC1)
Proteoglycans [BR:hsa00535]
 Cell surface proteoglycans
  Glypican family (GPI-anchored HSPG)
   2817 (GPC1)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Others
  2817 (GPC1)
SSDB
Motif
Pfam: Glypican
Other DBs
NCBI-GeneID: 2817
NCBI-ProteinID: NP_002072
OMIM: 600395
HGNC: 4449
Ensembl: ENSG00000063660
Vega: OTTHUMG00000133349
Pharos: P35052(Tbio)
UniProt: P35052 A0A384NPH9
LinkDB
Structure
PDB: 
4YWT 4BWE 4ACR 4AD7

Position
2q37.3
AA seq 558 aa
MELRARGWWLLCAAAALVACARGDPASKSRSCGEVRQIYGAKGFSLSDVPQAEISGEHLR
ICPQGYTCCTSEMEENLANRSHAELETALRDSSRVLQAMLATQLRSFDDHFQHLLNDSER
TLQATFPGAFGELYTQNARAFRDLYSELRLYYRGANLHLEETLAEFWARLLERLFKQLHP
QLLLPDDYLDCLGKQAEALRPFGEAPRELRLRATRAFVAARSFVQGLGVASDVVRKVAQV
PLGPECSRAVMKLVYCAHCLGVPGARPCPDYCRNVLKGCLANQADLDAEWRNLLDSMVLI
TDKFWGTSGVESVIGSVHTWLAEAINALQDNRDTLTAKVIQGCGNPKVNPQGPGPEEKRR
RGKLAPRERPPSGTLEKLVSEAKAQLRDVQDFWISLPGTLCSEKMALSTASDDRCWNGMA
RGRYLPEVMGDGLANQINNPEVEVDITKPDMTIRQQIMQLKIMTNRLRSAYNGNDVDFQD
ASDDGSGSGSGDGCLDDLCSRKVSRKSSSSRTPLTHALPGLSEQEGQKTSAASCPQPPTF
LLPLLLFLALTVARPRWR
NT seq 1677 nt   +upstreamnt  +downstreamnt
atggagctccgggcccgaggctggtggctgctatgtgcggccgcagcgctggtcgcctgc
gcccgcggggacccggccagcaagagccggagctgcggcgaggtccgccagatctacgga
gccaagggcttcagcctgagcgacgtgccccaggcggagatctcgggtgagcacctgcgg
atctgtccccagggctacacctgctgcaccagcgagatggaggagaacctggccaaccgc
agccatgccgagctggagaccgcgctccgggacagcagccgcgtcctgcaggccatgctt
gccacccagctgcgcagcttcgatgaccacttccagcacctgctgaacgactcggagcgg
acgctgcaggccaccttccccggcgccttcggagagctgtacacgcagaacgcgagggcc
ttccgggacctgtactcagagctgcgcctgtactaccgcggtgccaacctgcacctggag
gagacgctggccgagttctgggcccgcctgctcgagcgcctcttcaagcagctgcacccc
cagctgctgctgcctgatgactacctggactgcctgggcaagcaggccgaggcgctgcgg
cccttcggggaggccccgagagagctgcgcctgcgggccacccgtgccttcgtggctgct
cgctcctttgtgcagggcctgggcgtggccagcgacgtggtccggaaagtggctcaggtc
cccctgggcccggagtgctcgagagctgtcatgaagctggtctactgtgctcactgcctg
ggagtccccggcgccaggccctgccctgactattgccgaaatgtgctcaagggctgcctt
gccaaccaggccgacctggacgccgagtggaggaacctcctggactccatggtgctcatc
accgacaagttctggggtacatcgggtgtggagagtgtcatcggcagcgtgcacacgtgg
ctggcggaggccatcaacgccctccaggacaacagggacacgctcacggccaaggtcatc
cagggctgcgggaaccccaaggtcaacccccagggccccgggcctgaggagaagcggcgc
cggggcaagctggccccgcgggagaggccaccttcaggcacgctggagaagctggtctcc
gaagccaaggcccagctccgcgacgtccaggacttctggatcagcctcccagggacactg
tgcagtgagaagatggccctgagcactgccagtgatgaccgctgctggaacgggatggcc
agaggccggtacctccccgaggtcatgggtgacggcctggccaaccagatcaacaacccc
gaggtggaggtggacatcaccaagccggacatgaccatccggcagcagatcatgcagctg
aagatcatgaccaaccggctgcgcagcgcctacaacggcaacgacgtggacttccaggac
gccagtgacgacggcagcggctcgggcagcggtgatggctgtctggatgacctctgcagc
cggaaggtcagcaggaagagctccagctcccggacgcccttgacccatgccctcccaggc
ctgtcagagcaggaaggacagaagacctcggctgccagctgcccccagcccccgaccttc
ctcctgcccctcctcctcttcctggcccttacagtagccaggccccggtggcggtaa

KEGG   Homo sapiens (human): 6382
Entry
6382              CDS       T01001                                 

Gene name
SDC1, CD138, SDC, SYND1, syndecan
Definition
(RefSeq) syndecan 1
  KO
K06257  syndecan 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04512  ECM-receptor interaction
hsa04514  Cell adhesion molecules
hsa05144  Malaria
hsa05205  Proteoglycans in cancer
hsa05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    6382 (SDC1)
   04514 Cell adhesion molecules
    6382 (SDC1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    6382 (SDC1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    6382 (SDC1)
  09174 Infectious disease: parasitic
   05144 Malaria
    6382 (SDC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    6382 (SDC1)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    6382 (SDC1)
   00535 Proteoglycans [BR:hsa00535]
    6382 (SDC1)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Acrosomal exocytosis proteins
    6382 (SDC1)
CD molecules [BR:hsa04090]
 Proteins
  6382 (SDC1)
Proteoglycans [BR:hsa00535]
 Cell surface proteoglycans
  Syndecan family (transmembrane HSPG)
   6382 (SDC1)
SSDB
Motif
Pfam: Syndecan Romo1 DUF3592 Glycophorin_A Herpes_TAF50
Other DBs
NCBI-GeneID: 6382
NCBI-ProteinID: NP_001006947
OMIM: 186355
HGNC: 10658
Ensembl: ENSG00000115884
Vega: OTTHUMG00000090751
Pharos: P18827(Tbio)
UniProt: P18827
LinkDB
Position
2p24.1
AA seq 310 aa
MRRAALWLWLCALALSLQPALPQIVATNLPPEDQDGSGDDSDNFSGSGAGALQDITLSQQ
TPSTWKDTQLLTAIPTSPEPTGLEATAASTSTLPAGEGPKEGEAVVLPEVEPGLTAREQE
ATPRPRETTQLPTTHLASTTTATTAQEPATSHPHRDMQPGHHETSTPAGPSQADLHTPHT
EDGGPSATERAAEDGASSQLPAAEGSGEQDFTFETSGENTAVVAVEPDRRNQSPVDQGAT
GASQGLLDRKEVLGGVIAGGLVGLIFAVCLVGFMLYRMKKKDEGSYSLEEPKQANGGAYQ
KPTKQEEFYA
NT seq 933 nt   +upstreamnt  +downstreamnt
atgaggcgcgcggcgctctggctctggctgtgcgcgctggcgctgagcctgcagccggcc
ctgccgcaaattgtggctactaatttgccccctgaagatcaagatggctctggggatgac
tctgacaacttctccggctcaggtgcaggtgctttgcaagatatcaccttgtcacagcag
accccctccacttggaaggacacgcagctcctgacggctattcccacgtctccagaaccc
accggcctggaggctacagctgcctccacctccaccctgccggctggagaggggcccaag
gagggagaggctgtagtcctgccagaagtggagcctggcctcaccgcccgggagcaggag
gccaccccccgacccagggagaccacacagctcccgaccactcatctggcctcaacgacc
acagccaccacggcccaggagcccgccacctcccacccccacagggacatgcagcctggc
caccatgagacctcaacccctgcaggacccagccaagctgaccttcacactccccacaca
gaggatggaggtccttctgccaccgagagggctgctgaggatggagcctccagtcagctc
ccagcagcagagggctctggggagcaggacttcacctttgaaacctcgggggagaatacg
gctgtagtggccgtggagcctgaccgccggaaccagtccccagtggatcagggggccacg
ggggcctcacagggcctcctggacaggaaagaggtgctgggaggggtcattgccggaggc
ctcgtggggctcatctttgctgtgtgcctggtgggtttcatgctgtaccgcatgaagaag
aaggacgaaggcagctactccttggaggagccgaaacaagccaacggcggggcctaccag
aagcccaccaaacaggaggaattctatgcctga

KEGG   Homo sapiens (human): 6383
Entry
6383              CDS       T01001                                 

Gene name
SDC2, CD362, HSPG, HSPG1, SYND2
Definition
(RefSeq) syndecan 2
  KO
K16336  syndecan 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules
hsa05144  Malaria
hsa05205  Proteoglycans in cancer
hsa05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    6383 (SDC2)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    6383 (SDC2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    6383 (SDC2)
  09174 Infectious disease: parasitic
   05144 Malaria
    6383 (SDC2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    6383 (SDC2)
   00535 Proteoglycans [BR:hsa00535]
    6383 (SDC2)
CD molecules [BR:hsa04090]
 Proteins
  6383 (SDC2)
Proteoglycans [BR:hsa00535]
 Cell surface proteoglycans
  Syndecan family (transmembrane HSPG)
   6383 (SDC2)
SSDB
Motif
Pfam: Syndecan Glycophorin_A DUF5305 DUF2721 ATG22 Cadherin_C_2 Peptidase_M50 DUF3275
Other DBs
NCBI-GeneID: 6383
NCBI-ProteinID: NP_002989
OMIM: 142460
HGNC: 10659
Ensembl: ENSG00000169439
Vega: OTTHUMG00000164689
Pharos: P34741(Tbio)
UniProt: P34741 A0A024R9D1
LinkDB
Structure
PDB: 
6ITH

Position
8q22.1
AA seq 201 aa
MRRAWILLTLGLVACVSAESRAELTSDKDMYLDNSSIEEASGVYPIDDDDYASASGSGAD
EDVESPELTTSRPLPKILLTSAAPKVETTTLNIQNKIPAQTKSPEETDKEKVHLSDSERK
MDPAEEDTNVYTEKHSDSLFKRTEVLAAVIAGGVIGFLFAIFLILLLVYRMRKKDEGSYD
LGERKPSSAAYQKAPTKEFYA
NT seq 606 nt   +upstreamnt  +downstreamnt
atgcggcgcgcgtggatcctgctcaccttgggcttggtggcctgcgtgtcggcggagtcg
agagcagagctgacatctgataaagacatgtaccttgacaacagctccattgaagaagct
tcaggagtgtatcctattgatgacgatgactacgcttctgcgtctggctcgggagctgat
gaggatgtagagagtccagagctgacaacatctcgaccacttccaaagatactgttgact
agtgctgctccaaaagtggaaaccacgacgctgaatatacagaacaagatacctgctcag
acaaagtcacctgaagaaactgataaagagaaagttcacctctctgactcagaaaggaaa
atggacccagccgaagaggatacaaatgtgtatactgagaaacactcagacagtctgttt
aaacggacagaagtcctagcagctgtcattgctggtggagttattggctttctctttgca
atttttcttatcctgctgttggtgtatcgcatgagaaagaaggatgaaggaagctatgac
cttggagaacgcaaaccatccagtgctgcttatcagaaggcacctactaaggagttttat
gcgtaa

KEGG   Homo sapiens (human): 6385
Entry
6385              CDS       T01001                                 

Gene name
SDC4, SYND4
Definition
(RefSeq) syndecan 4
  KO
K16338  syndecan 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04512  ECM-receptor interaction
hsa04514  Cell adhesion molecules
hsa05205  Proteoglycans in cancer
hsa05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    6385 (SDC4)
   04514 Cell adhesion molecules
    6385 (SDC4)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    6385 (SDC4)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    6385 (SDC4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:hsa00535]
    6385 (SDC4)
Proteoglycans [BR:hsa00535]
 Cell surface proteoglycans
  Syndecan family (transmembrane HSPG)
   6385 (SDC4)
SSDB
Motif
Pfam: Syndecan Glycophorin_A
Other DBs
NCBI-GeneID: 6385
NCBI-ProteinID: NP_002990
OMIM: 600017
HGNC: 10661
Ensembl: ENSG00000124145
Vega: OTTHUMG00000033083
Pharos: P31431(Tbio)
UniProt: P31431
LinkDB
Position
20q13.12
AA seq 198 aa
MAPARLFALLLFFVGGVAESIRETEVIDPQDLLEGRYFSGALPDDEDVVGPGQESDDFEL
SGSGDLDDLEDSMIGPEVVHPLVPLDNHIPERAGSGSQVPTEPKKLEENEVIPKRISPVE
ESEDVSNKVSMSSTVQGSNIFERTEVLAALIVGGIVGILFAVFLILLLMYRMKKKDEGSY
DLGKKPIYKKAPTNEFYA
NT seq 597 nt   +upstreamnt  +downstreamnt
atggcccccgcccgtctgttcgcgctgctgctgttcttcgtaggcggagtcgccgagtcg
atccgagagactgaggtcatcgacccccaggacctcctagaaggccgatacttctccgga
gccctaccagacgatgaggatgtagtggggcccgggcaggaatctgatgactttgagctg
tctggctctggagatctggatgacttggaagactccatgatcggccctgaagttgtccat
cccttggtgcctctagataaccatatccctgagagggcagggtctgggagccaagtcccc
accgaacccaagaaactagaggagaatgaggttatccccaagagaatctcacccgttgaa
gagagtgaggatgtgtccaacaaggtgtcaatgtccagcactgtgcagggcagcaacatc
tttgagagaacggaggtcctggcagctctgattgtgggtggcatcgtgggcatcctcttt
gccgtcttcctgatcctactgctcatgtaccgtatgaagaagaaggatgaaggcagctat
gacctgggcaagaaacccatctacaagaaagcccccaccaatgagttctacgcgtga

DBGET integrated database retrieval system